KEGG   Schizosaccharomyces pombe (fission yeast): SPBC947.05c
Entry
SPBC947.05c       CDS       T00076                                 

Gene name
frp2
Definition
(RefSeq) putative ferric-chelate reductase Frp2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FAD_binding_8 NAD_binding_6 Ferric_reduct NAD_binding_1
Other DBs
NCBI-GeneID: 2541227
NCBI-ProteinID: NP_595271
PomBase: SPBC947.05c
UniProt: O94727
Position
II:667125..668819
AA seq 564 aa
MILARDDKWTLGSIALIFVLLIGFALLFLLERFRVKEKSRTFKDCVNVYQCPSKGERVYL
ALRHWFIFLATHKAQMTLILSPLVMLVTIPFTGKETKNSIASYDWNLTGVAARLGYLSCG
LFFVSYFFSLKNNPFCLMLFSSHEKMNYLHRWLSVYAVLISVLHGILFMIFSAQSYKPLL
YDKISIYGYFITVVLFLMTVASLPSVRRKFFEWFFVLHHTCSVLIIFLIWLHHPRTIVYM
KACIIIYAFDRGCRLFRSIWNRSNFRIYLLNEDMIYMVGRKPKRSFFALPWAAGSHVYIN
IPSLSYWQVHPFTLASAPFDDFIELFVAVHSGFTERLANRLYSMPHEYPNFSLAPGTPES
LSNTYRELNSFKSYAVEIENTAQGHTYEPEDLYLETTVFMDGPYGTTSNVFKEYSYVLLI
AGGVGFSYTLPILRDLILKECNVTSITFIWSCRSLSLLKVASKSLNSLLHQSNVRLKIIN
HFTGSISCKESSEFSNQTTENSEMEFFDDRPDLDMYIQKFFDYVGYQTAALAACGSQSFL
KRIKNSVNKSISSTTDIYQHYEEL
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgattttagctagagatgacaaatggactttaggctcgattgccctgattttcgtgctg
cttatagggtttgcattgctcttccttctggagcgttttcgagtcaaagaaaagtctcgg
acctttaaagactgtgtaaacgtttatcaatgtccgagtaagggagaaagagtttatctg
gcgctgagacactggtttatatttttggctactcacaaagcacaaatgacattaatatta
tctccattggtaatgttggttaccattcctttcactggtaaggaaacaaaaaatagtatt
gcatcctatgattggaacttaaccggtgttgctgcacgactgggttatctctcttgtggt
cttttctttgtttcctactttttcagtttaaaaaataatcctttttgcctgatgttgttt
tcatcgcatgaaaaaatgaactatcttcatcgctggctgtctgtatatgccgttctcatc
agtgtactgcatggaatactctttatgatattttcagctcaaagctataaaccacttctg
tatgataaaatatcgatctacggatacttcattacggtagtgttgtttctaatgaccgtg
gccagtcttccttctgtgcgtaggaaattttttgagtggtttttcgtcctgcatcacact
tgtagcgttttgataatctttctcatatggctgcatcaccccagaaccattgtttatatg
aaagcttgtatcattatatacgcattcgacagaggatgcagactatttagaagcatttgg
aatcgctcaaattttcgcatttacctattgaatgaagacatgatatatatggtgggtcgt
aaaccgaaaagatcgttttttgcattgccatgggctgctggaagtcatgtttacataaac
attccctccctcagttattggcaagtccatccctttaccttagcaagcgctccttttgac
gattttattgaactttttgtcgccgtccactcaggatttactgaaaggctggctaaccgc
ttatactctatgccccatgaatatcctaacttttcgctcgcaccagggactcccgagtct
ttgtcgaatacgtatcgtgaattgaatagtttcaaatcttacgccgttgagattgaaaat
accgcacaaggacacacgtatgagcctgaagacttatacctagaaacgactgtttttatg
gatggcccctatggcactacgtccaatgtattcaaagagtactcttatgttctgcttatt
gcggggggcgtagggttttcatatactttgccaattcttcgcgatttaattttaaaagaa
tgtaatgttactagcatcacatttatctggagttgtcgatcgctttccctattaaaagtt
gcttcgaaatctctaaactcgcttttacatcagagcaatgttcgcctaaaaattataaac
cattttaccggcagcatctcatgtaaagagtcttctgaattttcgaaccaaacaaccgaa
aattctgaaatggaattttttgatgacaggcctgatctagacatgtacattcaaaaattt
tttgattatgtcggatatcaaacagctgcattagcagcgtgtggttcccagagttttttg
aaacgcatcaaaaactccgtaaacaaaagtatatcatctacgactgatatttaccagcac
tatgaagagctctaa

DBGET integrated database retrieval system