KEGG   Schizosaccharomyces pombe (fission yeast): SPBC947.07
Entry
SPBC947.07        CDS       T00076                                 

Name
(RefSeq) putative ribosome biogenesis protein Rrp14-C
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SURF6
Other DBs
NCBI-GeneID: 2541261
NCBI-ProteinID: NP_595269
PomBase: SPBC947.07
UniProt: O43082
Position
II:complement(660384..661085)
AA seq 233 aa
METTEGKNDLRAKLAEKIQTFRSQRKATEKVDRALLLQRRKEKAKARAEAKKLAKKESKA
KQESKVAAYDTGNSSDNIADEENDNHKSTITYGTLIVGDDKFSNGKLKVAGKKRGPTDVF
GALKHLEAKKRRIESMDEEKRRKIEESDKWHRVLLQAEGKKLKDNEQLLKKSIRRKEKEK
KKSSDAWKERKDNEKKAMLMRQQRREENLKKRRESKKSKKGKAPKKKKPSKKK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggaaacaactgaaggaaaaaatgacttacgagcaaagcttgctgaaaagattcagaca
tttcgctctcaaagaaaagctactgaaaaagtagaccgtgctctacttttacagcgcaga
aaagaaaaggcaaaagctcgtgctgaagcgaagaagttagctaaaaaggagtcaaaggct
aaacaggaatcaaaagtggcagcttatgacactgggaactcttctgataacattgctgac
gaggaaaatgacaaccacaagagcactattacttatggtactttaatagtcggagatgac
aaattctcgaatggtaaactaaaagttgccggaaaaaagcgaggtcctactgatgtcttt
ggcgctctaaagcatttggaagccaagaaacgccgtattgaaagcatggacgaagagaaa
aggagaaaaattgaagaaagtgataaatggcatagagttttgcttcaggcagaagggaaa
aaactcaaagataacgagcaattgcttaaaaagagcattcgtcgcaaagaaaaggaaaag
aaaaagtcttcagacgcttggaaggaaaggaaggacaacgaaaaaaaagcaatgttaatg
cggcagcaacgtagagaagaaaatttgaaaaaacgtagagaaagtaaaaagtctaagaag
gggaaggcaccaaaaaagaagaagccatccaagaaaaaatag

DBGET integrated database retrieval system