KEGG   Schizosaccharomyces pombe (fission yeast): SPBC947.08c
Entry
SPBC947.08c       CDS       T00076                                 

Gene name
hip4
Definition
(RefSeq) histone promoter control protein Hip4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HUN
Other DBs
NCBI-GeneID: 2541284
NCBI-ProteinID: NP_595268
PomBase: SPBC947.08c
UniProt: O43083
Position
II:659085..660101
AA seq 338 aa
MSLLSGDQRIICLEIPLQGKENVHINFAKEVEKLYGPSVQENSKKNDLSDSADSEGESTH
VDEQQAANGAADGTQTIKKKKRKRRYADEYYDRTDPFIDDAELYIEEKAAATKDGFFVFS
GPLVAEGDTVKIERSKKTKKKKKTSLSNATHPAPAVSAVVASADASFDDSRDIESEDEQP
LRTLSIEMAAKNALKEAKRENAKVPKDVSKKEAKTTKSKEKATKKTSSSVPKQSTGENTK
KAVKLETPLTSTPPIPPLSEPKHSPATVNEHISPPSALTNPSTEELKPSTSLPIDQGNAS
VVSKPTQQVSIVLSQNASLPVDEHQAEPEKSIPTSSIP
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtcgcttttgtctggcgaccaacgaattatttgcttggaaattcctttgcaaggcaaa
gaaaacgtacatattaattttgcaaaagaagtggaaaaactttatggaccctctgttcag
gagaattcaaaaaaaaatgatctttcagactcagcggattctgagggcgaaagtacacat
gttgatgagcaacaagcagctaatggggcggccgatggtacacagaccataaagaaaaag
aaaaggaaaaggaggtacgctgacgaatactacgatagaacagatccctttattgatgat
gctgagctctacattgaagagaaggctgccgctaccaaagatggattttttgtatttagc
ggtccactcgtggccgaaggagatactgtgaaaatcgaaagatcaaagaagactaagaaa
aagaagaaaacatctttatccaatgctacacaccctgcgccagctgtctctgcggtggtg
gcttcagcggatgctagctttgacgatagtagggatattgaatctgaggacgagcagcca
ttaaggactttgtccattgaaatggctgctaagaatgctttaaaagaggcaaaacgggaa
aatgcaaaggttcccaaggatgtctctaagaaggaagcaaaaacaacgaaaagcaaagag
aaagccacaaaaaagacatcctcttcagtgcccaaacaaagtacgggagaaaataccaaa
aaggctgttaaacttgagacacctcttacatctacaccccctataccacctctctctgaa
ccaaagcattctcccgctactgttaatgagcacatttctcctccaagtgctttaactaat
ccttctacggaggaactcaaaccttcgacctccctacctattgatcagggcaatgcttct
gtcgtttcgaaacctactcaacaagtaagcatcgttctttctcagaatgcatccttaccc
gttgatgaacatcaagctgaaccagagaaatcaattccaactagtagcatcccataa

DBGET integrated database retrieval system