KEGG   Schizosaccharomyces pombe (fission yeast): SPBP16F5.02
Entry
SPBP16F5.02       CDS       T00076                                 
Symbol
mcs2
Name
(RefSeq) TFIIH complex cyclin Mcs2
  KO
K06634  cyclin H
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBP16F5.02 (mcs2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBP16F5.02 (mcs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBP16F5.02 (mcs2)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBP16F5.02 (mcs2)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBP16F5.02 (mcs2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBP16F5.02 (mcs2)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 2540555
NCBI-ProteinID: NP_595776
PomBase: SPBP16F5.02
UniProt: P36613
Position
II:1892961..1894408
AA seq 322 aa
MSADKFRDSTHYRDWIFTEEDLSKTRAKVNEKFTNIVRERMLEELSLQNKEASLEVLPPT
LTVEEELELVNYYSFQLNALSSALSLPTHIRSTAILFFKRFYLINSVMEYSPKIISFTSL
FLATKCNDHYISIEQFCKNMPKTTPEEVLEYEFNVCQSLKWDLYVWLPFRPLQGFLLDCQ
TVLPKVAVEKFYECHDLSKKFLIETLHSDIYFLHSPSIIALGAIYHTNPTICLQYIEAKK
IPELQPLIISISANLKATKKFKIEKKKAQDYGRKLYFCMNPLRNKSSALYLKRKAEEEST
NNNKWAKKFSTSSNVLDKNPFE
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtctgccgataaatttcgtgattccacgcattacagagattggatttttacggaagaa
gacctttcaaaaacacgtgctaaagtaaatgaaaaatttacgaatattgtacgtgagcga
atgctggaagagttgtctttacaaaacaaggaagcatccttagaagttttgcctccaact
cttaccgttgaagaagaacttgaacttgtaaattattatagtttccagttgaacgcactt
tcttccgctctttccttaccaactcatattcgctccacggccattcttttttttaaacgc
ttttatctaattaactctgtcatggagtatagtccaaaaattatttcgtttacttcttta
tttttagctaccaagtgcaacgatcattatatctctattgaacaattctgtaaaaacatg
cccaagacgactcccgaagaagttcttgaatacgaatttaacgtttgtcaatcattaaaa
tgggacctttacgtctggcttccatttcgtcctttacaaggcttccttttagattgtcaa
acagtgcttccgaaagttgctgtcgaaaagttttacgaatgtcatgacctttccaaaaaa
ttcctaattgagacattgcattctgacatctatttcttacattcacccagcataattgct
ttgggtgctatttatcatacgaatccaactatttgtttacaatatatagaagcaaaaaaa
attccagaactgcaacctttgataatttcgatttctgccaatttgaaagctacaaaaaaa
tttaagattgagaaaaaaaaggcacaagattacggcagaaagctatatttctgcatgaat
cctctgcgaaacaagtctagtgctttgtaccttaaacgaaaagcggaagaagaatcaact
aataacaacaaatgggctaaaaagttctcaaccagcagtaatgtgttggataaaaatccg
tttgaatga

DBGET integrated database retrieval system