KEGG   Schizosaccharomyces pombe (fission yeast): SPBP16F5.07Help
Entry
SPBP16F5.07       CDS       T00076                                 

Gene name
apm1
Definition
(RefSeq) AP-1 adaptor complex mu subunit Apm1
  KO
K12393  AP-1 complex subunit mu
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBP16F5.07 (apm1)
Membrane trafficking [BR:spo04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    SPBP16F5.07 (apm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 2541306
NCBI-ProteinID: NP_595781
PomBase: SPBP16F5.07
UniProt: Q9HFE5
Position
II:join(1910180..1910241,1910317..1910422,1910493..1911140,1911219..1911683)
Genome map
AA seq 426 aa AA seqDB search
MASAIFVLNLKGKVIISRDYRADIPMSVVEKFLPLKSEVEEEQGFSTPCLTHEGINYIYI
HHNDVYLLALSKMNSDAMEMLVFLRKMADVFIDYFKELQEESIRDNFVLVYELLDEIMDF
GFPQTTETKILQEYITQTSNTVKKHAPPPIAMTNAISWRSEGIHYRKNEVFLDVIESVNL
IAAADGTVIQSEILGKVRLKCYLSGMPELRLGLNDKVLFEAAGRTIKGNTVEMEDVKFHQ
CVRLARFENDRTISFIPPDGEFDLMSYRMSSNVRPLIWVECESIVHSGSRIEFMVKAKAQ
FKKRCIANNVQIIIPVPEDADSPRFQTSNGHVQYAPEQAAMVWNIKKFAGGKEFFMRAEM
GLPSVKNEDIQVQKKRPVQLKFAIPYFTTSGIQVRYLKITEPKLNYHAMPWVRYVTQNGT
EYSIRQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctatattcgttctgaatttaaagggaaaggtaatcatttcccgtgattac
cgagctgatatccccatgtcagtagttgaaaagtttttacctttaaaatcagaagttgaa
gaagaacaaggattctccaccccttgtctcactcacgaaggcattaactacatttacatt
caccataatgatgtctacctccttgctttatccaaaatgaattccgatgcaatggagatg
ctagtatttttgcgtaaaatggcggacgtttttatagattactttaaagaattgcaggaa
gagtcgattcgagataactttgttcttgtttatgaattgttagacgagatcatggatttc
ggttttccacaaacaactgaaacaaaaatcttgcaagaatacatcactcaaacctcaaat
acggtaaaaaagcatgctccaccccccattgctatgacaaatgctatctcctggcgttct
gaaggaattcactatcgtaagaatgaagtatttttggacgttattgaatcagttaattta
attgctgctgccgatggtacggtcattcaaagtgaaatcttaggaaaagttcgtctcaaa
tgctacttatcaggaatgcctgaacttcgtcttgggctcaatgacaaggtccttttcgaa
gcggctggtcgtaccattaaaggaaacactgtggaaatggaagatgtgaaatttcaccaa
tgtgttcgtcttgctcgatttgaaaacgatcgtacaatttcgttcattcctcctgatggc
gaatttgatttaatgtcctatcgcatgagttcaaatgtacggccattaatttgggttgaa
tgtgaatccatcgtgcattcaggttcgagaattgagtttatggtaaaagctaaggctcaa
ttcaaaaagcgttgtattgcaaataatgtccaaatcatcattcccgttccggaagatgct
gacagtcctcggtttcaaactagcaatggtcatgtgcaatatgcacctgaacaagctgcc
atggtttggaacattaagaaatttgcaggtggtaaagaatttttcatgcgtgctgaaatg
ggtttaccaagtgttaaaaatgaagatattcaagttcagaaaaaacgtcctgttcaacta
aaatttgctattccctatttcactacctcagggatccaagttcgttatttaaaaatcacc
gaaccaaaacttaattatcatgctatgccttgggttcgatatgttacacaaaatggtact
gaatattccatccgtcagtaa

DBGET integrated database retrieval system