KEGG   Schizosaccharomyces pombe (fission yeast): SPBP23A10.08Help
Entry
SPBP23A10.08      CDS       T00076                                 

Gene name
alp5
Definition
(RefSeq) actin-like protein Arp4
  KO
K11400  actin-related protein 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBP23A10.08 (alp5)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NuA4 complex
     SPBP23A10.08 (alp5)
  Chromatin remodeling factors
   INO80 complex (yeast)
    SPBP23A10.08 (alp5)
   SWR1 complex
    SPBP23A10.08 (alp5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Actin MreB_Mbl FtsA
Motif
Other DBs
NCBI-GeneID: 2541318
NCBI-ProteinID: NP_595820
PomBase: SPBP23A10.08
UniProt: Q9P7X7
Position
II:2013062..2014363
Genome map
AA seq 433 aa AA seqDB search
MTSAFYGGDEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFGEEYIYKSN
PGMEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLET
MFESLRCPATYLAKQETCAAFASGKGTACLVDIGAERSSVSAIYDGFVLQKGYQVQHFSG
NAINDILAQTLRDKNFEVMPKYLVKSKNPVEIGQPANCELRPRDTTDSYHQFQVQRVYDE
WKEECALISDVPFSSETTIAESEFEFPDGSRMMFGAERYQIPEHLFVPGSDEEMNEEPSK
PIEQTENNEVSQQDSSVTNTSSRILGIPQLFQNCISECDVDIRASLLNNVIVCGGTSLMQ
GFSLRLQNELSKLYPGSRLKIHASGHVVERSYASWLGGSILSSLGTFHQLWISRQEYEEH
GSDRLALIEKRCK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactagcgcattttatggcggagatgaagtttcagctattgtaattgatcctggaagc
aaatggactcgaataggtttttctggagaagatattcccaaatgcgtactccctagctac
tgtggagagttcagtgatggcagacggttgttcggtgaggaatacatatataaatcaaac
cctggaatggaaataaaaaatgcaattcgtaatggttgggttgaaaattgggatgttact
gtagatctctggcgttatggattagagcagcagttgaagactaatcctttagagcatcca
atcttgattacggaaccatttgataatcccccagaaaatcgagtgaaaacactagaaacg
atgtttgaatctttgcgttgtcctgcaacatacctcgccaagcaggagacgtgtgcggcg
tttgcaagcgggaaaggtactgcttgtttagtagacattggtgcggagcgtagctcggtg
tctgctatatatgatggttttgtgcttcaaaaaggctatcaggttcaacatttttctggg
aatgcaattaacgatattttggcgcaaactctcagggataagaatttcgaagtgatgcct
aagtacttagtgaaaagcaaaaatccagtggagatagggcagccagctaattgtgagtta
cgtcctcgtgatactacagattcttatcatcaatttcaggtccagcgagtctacgatgaa
tggaaagaagaatgtgctctcatttccgatgttccattttcatctgaaaccacgattgct
gaatcagagttcgaatttccagacggttcccgtatgatgtttggcgcggaacgctatcaa
attcctgaacatttgtttgtgccaggaagtgatgaagaaatgaacgaggaaccttcgaag
ccaatagaacaaaccgaaaataatgaggtatcacaacaagattcttcggttaccaacact
tcttctcgcattttggggatacctcagttgttccagaactgtatttcggaatgcgatgtt
gatatccgtgcttctttgctcaacaatgttattgtttgtggaggcactagtttgatgcaa
ggattctctcttcgtctgcaaaatgaactttcaaaattatatcctggcagccgtcttaaa
atccatgcttccggtcatgttgttgaacgcagttatgcttcatggttaggtggatctatt
ttaagtagtcttggaacgtttcatcaattatggatatcacgtcaagaatatgaagaacat
ggttctgatcgtttggctttaatcgaaaaacgatgtaaataa

DBGET integrated database retrieval system