KEGG   Schizosaccharomyces pombe (fission yeast): SPBP23A10.12
Entry
SPBP23A10.12      CDS       T00076                                 

Gene name
frg1
Definition
(RefSeq) putative FRG1 family mRNA-processing protein
  KO
K13122  protein FRG1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBP23A10.12 (frg1)
Spliceosome [BR:spo03041]
 Complex C
  Other components
   Complex C specific factors
    SPBP23A10.12 (frg1)
SSDB
Motif
Pfam: FRG1 Fascin
Other DBs
NCBI-GeneID: 2541328
NCBI-ProteinID: NP_595824
PomBase: SPBP23A10.12
UniProt: Q9P7X3
Position
II:join(2023949..2023986,2024059..2024178,2024239..2024697,2024769..2024889)
AA seq 245 aa
MSMRLTFKGDKKIQKKKKKNTKSLQSSLESAENDPFWTDANELNELEGPAVIYKIDDDAG
VSLGIEEVKESCVLLPLDKVSLEPELTRQVFLLSILNNTILLKSCLGKYMSCSKSGDLYC
TQEAVGSQEQWIAENLGSGFWAWKSVSTKKYLTLSREKQDQAIACVSDTVIPEAKWRIRV
QTRFLKKNKSSLFDNPTIHSRQLESMAGRKLSTDEKKTLKKAFKEGVLHEALLDLRVSSR
SDKYG
NT seq 738 nt   +upstreamnt  +downstreamnt
atgtctatgcgattaactttcaagggagacaaaaagattcaaaagaagaaaaaaaagaac
acaaaatcacttcaatcttctctagaatcagctgaaaacgatcctttttggacggacgca
aacgagctaaatgagcttgagggtccagcggttatatataaaatagacgatgatgctggt
gtatctcttggaattgaagaagttaaagaaagttgcgttcttcttcccctcgacaaagtt
tcgctagagccagaattgacgcgccaggtgtttttgttatccatactgaacaatactata
ctattgaaaagctgtttaggtaaatacatgtcatgtagtaagtctggagacttgtattgt
acgcaagaggcggtaggatcacaggaacaatggatagcggagaatctgggctcaggattt
tgggcttggaaaagtgtatcaacgaaaaaatatttaacattaagtagagaaaaacaagat
caggccattgcatgtgtctctgacactgtcattcctgaagccaaatggagaattcgagta
caaactcgtttcctaaagaaaaacaagtcttctttatttgacaacccaaccatacattcc
agacaattagaatctatggctggaagaaaactttctaccgatgaaaaaaagaccctcaaa
aaagcgtttaaggaaggagttcttcatgaagcattactagatttacgagtatcttcaagg
agcgacaaatatggttaa

DBGET integrated database retrieval system