KEGG   Schizosaccharomyces pombe (fission yeast): SPBP26C9.03c
Entry
SPBP26C9.03c      CDS       T00076                                 

Gene name
fet4
Definition
(RefSeq) putative iron/zinc ion transporter
  KO
K19792  low-affinity ferrous iron transport protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBP26C9.03c (fet4)
Transporters [BR:spo02000]
 Other transporters
  Others
   SPBP26C9.03c (fet4)
SSDB
Motif
Pfam: Iron_permease MalF_P2
Other DBs
NCBI-GeneID: 2541302
NCBI-ProteinID: NP_595134
PomBase: SPBP26C9.03c
UniProt: Q9HFE1
Position
II:complement(327992..329746)
AA seq 584 aa
MTASITEIDSISEESNVESVSHLQHSPSFEKKGADFSISLNEKKDFASPITEEIPSPDGI
ATPEPETKKKLSFGARVWDLICSPGRQHDVCVAAPTQLVRSCDDYANSASTLVTNDDGTK
TKVDSDEKKHKHKNVRDYIRFKHVDIGGRIFDLITRLAGTSFTFILMLIILIVWAIVGGI
YRAPDNWQIVMQDGSSIQCYVSDTLLMRQQQNQHIQVLTMISQLRSRLLTTSRLLGPVLN
DKTKISSVNVALMKDDVGDAEKLPTENWFDFICNYVSFMVGSIIFLVVYWIGIFIWIGFG
RMLGWSDEWQLYINTAVAVELTFTSVFLQNVRHRHMKYIDRCVTSIFRIDSVIEEELRRM
MGDKEPNEEITIKMDKINLGERSIDYYADLIGSGVGVVVSTCVFVAWIAIGNVMHWDSNW
WLIIGTYTGLVGFLDGFVLRNVYFRESSKEATEIQTLIDEDYALYQKLDLPLPHEHITNY
KSTFGGSLSQWIGWLCALPISVLFSVFVILGLIIAAGSLRFNETAQLFCNTPTMIIEGAL
LIVLIEAHNIANLKRRIQFRQIHLRRLTILKMLAGDNYSTTSTV
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgactgcctctatcacagaaatcgacagtatttctgaagagtccaacgtcgaatcagtc
tctcatctccaacattccccttcgtttgagaaaaaaggcgctgacttttccatttctctt
aacgaaaagaaagacttcgcttcccccattactgaagaaatcccttcccctgatggaatt
gctacacccgaacccgagacaaaaaagaagctttctttcggcgctcgcgtttgggattta
atctgttctccaggtagacaacacgatgtttgcgttgccgcccctactcaacttgtacgc
tcatgcgatgactatgccaatagtgcctccactctcgtcaccaatgatgatggaacaaag
acaaaggtcgattctgatgagaaaaaacacaagcataagaatgtgcgtgattatatcaga
tttaaacatgttgacattggtggacgaatcttcgatttgatcacaagattggctggcaca
agttttacttttatccttatgctaattatccttatcgtttgggcaatcgtaggtggtatt
tatcgcgctcctgataattggcaaatcgttatgcaagatggcagttctattcaatgttat
gtttccgacacattgcttatgcgtcaacagcagaatcaacatatccaagtactaactatg
atttcccaattgcgttcacgtcttcttactaccagtcgtctattgggccctgtgttaaat
gacaaaaccaaaatttcttccgtaaacgttgcactaatgaaagacgatgtgggtgatgct
gaaaagttacctactgaaaattggtttgattttatttgcaattacgttagttttatggta
ggctccattatcttccttgtcgtatactggattggaatctttatttggattggattcggt
cgtatgctaggatggtccgatgaatggcagttgtatattaataccgctgttgccgtcgag
ttgacctttacctctgttttccttcaaaatgttcgacaccgtcatatgaagtatattgat
cgttgtgtcacatctatcttccgcatcgattcagtaatagaagaagagctgcgcagaatg
atgggtgataaagaaccaaatgaagaaataaccattaaaatggataagatcaatcttggt
gagagatccattgattattatgctgatttaatcggttctggtgttggtgtggtcgttagt
acttgcgtgtttgtagcttggattgccatcggaaatgttatgcattgggattcaaattgg
tggcttattattggtacttataccggtcttgttggtttcttagatggtttcgttttgaga
aatgtctatttccgcgaaagttccaaagaagccacagaaattcaaacgctcatagacgag
gattacgccctttatcaaaagcttgatttaccacttcctcatgaacacataacaaactat
aaaagtacattcggaggttcgcttagtcagtggatcggctggttgtgtgcgttgcctatt
tccgttcttttctccgtatttgtgattcttggtctgatcattgcagctggatccttgaga
ttcaatgagactgctcaattgttttgtaacactccgactatgattattgagggtgctctt
ttgatcgttctgatcgaggctcacaatatagccaacttgaagcgtcgtatccaatttcga
caaattcatcttcgtcgtttgacaatcttgaaaatgcttgccggtgataactattcaacc
accagcactgtttaa

DBGET integrated database retrieval system