KEGG   Schizosaccharomyces pombe (fission yeast): SPBP35G2.06c
Entry
SPBP35G2.06c      CDS       T00076                                 

Gene name
nup131
Definition
(RefSeq) nucleoporin Nup131
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Nucleoporin_N Nucleoporin_C
Other DBs
NCBI-GeneID: 2541330
NCBI-ProteinID: NP_595381
PomBase: SPBP35G2.06c
UniProt: Q9P797
Position
II:complement(join(973049..974181,974223..974577,974617..975002,975044..975137,975172..976632))
AA seq 1142 aa
MFIVHRRFFQNEKAFTPAGKHEKVADGNKHETLATSEYPKVCASNDLYKILQISAPKVGN
FTIHDAPVVGLIDSILEYYLYISVKVRKAWIAGYGSQPQNLICFDWERFTGILDQQSLNS
PPLAGFVKPDPTSAEPGFLLLWPASGDLFYWERTSLMNVEVSAPEFPGFLHYRIQLKRYE
SCKNLVSAEPAGFFLTLSSGRLLHLNLKDSDGNSSIQVRILFPGLHIPNCLLSLYNSIFA
FTSGRVIPIRCGSIKGPGERLVYSMHSGSTLRIWEIFGTGDHHLLRGFDIYDIILDSIQE
SFSYVNRFLILDFSVSTSDPYTLACLVSWRDNASLFNYAAIIISFNHQMIPHVSQFCHVR
SYLSAILPSVCRIFLPSPGTVVFCVFDVTFAMFHKVRGKEGTFYVEENLVVNNLTSKSRV
LDFGMEDAIYEKSTHTLLKTPALILLTEGHGIIRIESSASYLKTSFSATTYLRSRLSQFA
SQSPLFREQFLLNFDFTYNLSESEVYNTVFNLCDELYTTPCKKNMSVLETLHSQQRDLME
IVLVAFKYLHLSPSNRLQLWLKVAYCSALADLYELLMCNEKMSNLLRRVLKIMSSNDNID
ELFLKKCLNINLLLQHLSSEYSQISGQDASNAQKRIEVIVNVNNVYGTIFGNELAYRQEK
ISKFTDPSSVIRSDLWTVEVDHLDLLRKQIEDSISLHRDVRDSKDAHILKVSNKLRKQIL
HLVEQNCLLIFDLHNGTDDTIVKSHNFQKFEEEFGNSRKEWLQYLASVGYLEKAIDLAEK
VKDFQTMVILLDCLDPKDPTIKLQKQKACLNKYKEEFADVIFFYLVDTEQYASLLHDFLE
YQSLLISFFEANDLLNLLWIFEAQNGNYGRASEILFRDCEPEENRIIGKISQLALAKLYS
WTNRIEGENIILSNETEVIENHLAILLIQEQYAEMLSSLVDITEDEGEAVEAIVTSNCVN
LSENSIRAWLVSSAVERLIQNEYTTLCEMVDFFSSFSLRECSFKEVDLALELLERATITK
DVYFYLKDLVYRRFLLQVNWAEIIDAHEDLESSFFPMVKEIMLESDFLIWLQHMEHNIHD
ESKHYLKSEKNFLQSVYSSLSESQVEDYQMELFREKQIFSVLCKDRELYILIPKLLDVAT
KQ
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgtttattgtacatcgacggttttttcaaaatgaaaaagcttttacgcctgcaggaaaa
catgaaaaagttgccgacggaaacaaacatgagacattagctacttcagaatacccgaaa
gtctgtgcatcaaatgacttgtacaaaatactccaaatatctgctcctaaggttggcaat
tttacaatccatgatgcgccagttgttggactaattgactctattttggaatattatttg
tatattagtgtcaaagttcgaaaggcatggattgctggttatggaagtcagccccaaaac
ttaatatgctttgattgggaacgttttacgggtattctagatcagcagagtctaaatagc
ccaccgttagctggatttgttaagccagatccaacatcagcagagcctggctttttactt
ttgtggcctgcttcgggcgaccttttctactgggaaagaacttctttgatgaacgttgag
gtttctgctcccgaatttcctggttttcttcattacaggattcaactaaaacgatatgaa
agctgtaaaaatttggttagtgctgagcctgctggctttttccttactctgagttcaggt
cggttgcttcatctgaatttaaaagatagcgatggcaattcctctattcaggttcgaatc
ctatttcctggattgcacatccccaactgcttgctgtcgttatacaacagtatctttgca
tttacttcaggaagagttattccaatacgttgtggttcaataaaaggacctggtgagaga
ttagtttattctatgcattctggaagcacattgcgaatttgggaaatattcgggactggt
gatcaccacttgttacgtggttttgacatttatgatataattttagatagtattcaggaa
tccttttcctacgtaaatcgatttctaatccttgatttttctgtttcaacctcggatcct
tatacgttagcttgtttggtttcctggcgtgataatgcttcattattcaattatgctgca
atcattatttctttcaaccatcagatgatacctcatgtttcacaattctgccatgtacgc
tcatatctttctgcaattcttccatcagtgtgtcgaatatttttaccaagtccaggtaca
gttgttttttgcgtcttcgatgtcacttttgctatgtttcataaagtgcgagggaaagaa
ggcactttttatgtcgaagaaaacctggttgtgaacaacctaacttccaaatctcgggtt
ttggattttggcatggaagatgcgatatatgaaaaatctacgcacaccttactaaaaact
ccagcattgatcttgttaacagaagggcatggtataatccgaattgaatcttctgctagc
tacctgaaaaccagctttagtgcaaccacctatttacgaagtcgtctctcccagtttgca
tcgcaaagccctttgttccgtgaacaatttttgttaaattttgactttacatacaacctc
tctgaaagcgaagtctataatacagtctttaatctttgtgatgaactttatacgacgcca
tgtaaaaaaaatatgtctgtattagaaacactacattctcagcaacgtgacttgatggaa
atagttcttgttgccttcaaatacctacatttatctccttctaatagacttcaattatgg
ctaaaagttgcctattgcagtgctttggcagacctatatgaattattgatgtgtaatgaa
aaaatgtctaacttgcttcgacgagtattgaaaataatgtcttcaaatgataatattgat
gaactttttttgaaaaagtgcctgaatataaatttgttattacagcatttaagctcggaa
tattctcaaatatctggccaagatgctagcaacgcacaaaaaagaattgaagtaatagta
aatgttaataacgtttatgggactatctttggaaatgagcttgcttataggcaagaaaaa
atatcaaaatttactgatccatcctctgtgattagaagcgacctttggacagttgaagtt
gatcacttagatttactacgaaaacagatcgaagattcgatatcattgcatcgcgatgta
cgtgactcgaaagatgcacacatattaaaagtcagtaacaagcttcggaagcagattttg
catctggtggaacaaaattgccttttgatctttgatttgcacaatggaacagatgatacc
atagtaaaatcgcataattttcaaaaatttgaagaagaatttggcaattcacgaaaagaa
tggttacaatatttagcttctgtcggatatttggaaaaggcaatcgacttggcggaaaaa
gttaaagactttcagacaatggtaattttgctggattgtctagatccaaaggatcctacc
attaagcttcaaaagcaaaaagcatgcttaaataaatacaaagaagaattcgcagatgta
atttttttttatttggttgatacagagcagtatgcgtctttgcttcatgatttcttggag
tatcaatcacttttaatatctttttttgaagccaatgatttattgaatcttttgtggata
tttgaagctcaaaatggaaattatggacgagcctccgaaattcttttccgtgattgtgaa
ccagaagaaaacaggattatcggtaaaatttcgcagttagctctagcaaagctctactca
tggactaatagaattgaaggtgaaaatatcatattgtcaaatgagactgaggtgattgaa
aatcatttagccattttgcttattcaagagcaatatgctgaaatgctttcatcacttgtg
gatattacagaagacgagggagaagctgtcgaagcaatagtaacttccaattgtgtaaat
ctatcagaaaactctatcagagcctggctcgtgtctagtgctgttgagcgattaattcaa
aacgaatacactacgctttgtgagatggtagatttcttttcttctttttcattacgggaa
tgttcattcaaagaagttgatttggccttagagttattagaaagagctacaatcactaag
gacgtgtatttttacttaaaagatctcgtatatcgccgttttctattacaggtgaactgg
gcagaaatcatcgatgcgcatgaagatttagaatcttcattttttccaatggtaaaggaa
attatgttagaatcagactttttaatatggttacaacatatggaacacaatattcacgac
gaaagtaaacattacttgaaatcggaaaaaaattttttgcaaagtgtatattcttcactt
tctgagtcgcaagtggaagattatcaaatggagctttttcgtgaaaagcaaattttctca
gtactatgtaaagatagagagttatacattctgattccgaaacttctggacgtagcaaca
aaacaatga

DBGET integrated database retrieval system