KEGG   Schizosaccharomyces pombe (fission yeast): SPBP35G2.12
Entry
SPBP35G2.12       CDS       T00076                                 
Name
(RefSeq) putative ADP-ribose diphosphatase subfamily NudF
  KO
K01515  ADP-ribose pyrophosphatase [EC:3.6.1.13 3.6.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00740  Riboflavin metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPBP35G2.12
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SPBP35G2.12
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     SPBP35G2.12
    3.6.1.-
     SPBP35G2.12
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 2541356
NCBI-ProteinID: NP_595387
PomBase: SPBP35G2.12
UniProt: Q9P791
Position
II:989558..990175
AA seq 205 aa
MSQDQKPKVLEVSNLENQDAKWTSLKKIRWQDEKGKIRFWEMAERTTRSEANVDAVAILA
IVPIDGSPHVLCQKQFRPPIGKFCIEIPAGLVDSKESCEDAAIRELREETGYVGTVMDST
TVMYNDPGLTNANLKIILADIDMSKPENQNPQQQLDDGEYIENFPIKLSSLQEELFSLEK
KGFAIDVRLSTFALGLHAGLKYLSS
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccaagatcaaaaacctaaagttttggaagtgtccaaccttgagaatcaggatgcc
aagtggacatccttaaagaaaatccgttggcaagacgaaaaaggaaaaatcaggttttgg
gaaatggctgaacgtacgacacgttcagaagccaatgtggatgccgtagccatcttagcc
attgttcctatcgacggaagtcctcatgtgttgtgccaaaagcaatttcgtcctcctatt
ggcaagttttgtattgaaattccagcaggtttagttgattctaaggagtcttgtgaagat
gctgcgattcgagagcttcgtgaagagactggctacgttggtactgttatggactccacc
actgtcatgtacaatgatccgggtcttacgaatgctaatcttaagattatactggctgac
attgacatgtcgaagcctgaaaaccaaaatcctcaacaacaacttgacgatggcgaatac
attgagaactttccaatcaagctttcttctttacaagaggaattattttctttagagaag
aagggatttgccattgatgttcgtctctccacatttgcactaggattacatgctggtctt
aaatacttgtcgtcttag

DBGET integrated database retrieval system