KEGG   Schizosaccharomyces pombe (fission yeast): SPBP4H10.06cHelp
Entry
SPBP4H10.06c      CDS       T00076                                 

Gene name
cut14
Definition
(RefSeq) condensin complex subunit Cut14
  KO
K06674  structural maintenance of chromosome 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBP4H10.06c (cut14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBP4H10.06c (cut14)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    SPBP4H10.06c (cut14)
   Condensin II
    SPBP4H10.06c (cut14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_29 APG6_N DUF2559 ABC_tran
Motif
Other DBs
NCBI-GeneID: 2541319
NCBI-ProteinID: NP_596180
PomBase: SPBP4H10.06c
UniProt: P41003
Position
II:complement(2877850..2881368)
Genome map
AA seq 1172 aa AA seqDB search
MKIEELIIDGFKSYAVRTVISNWDDQFNAITGLNGSGKSNILDAICFVLGITNMSTVRAQ
NLQDLIYKRGQAGITRASVTIVFNNRDPASSPIGFENHPQVSVTRQIIMGGTSKYLINGH
RALQQNVQNLFQSVQLNINNPNFLIMQGRITKVLNMKATEILSMIEEASGTRMFEERKEK
AFRTMQRKEAKVEEINTLLREEIEPRLTKLRTEKKTFLEYQHIYNDLERLSHLCTAYDYY
KLSLKVEELTVQASQKHSHIAEMESSLQTSKQEVLILKEKIKKIEDERMRQMSVSSDRTL
DSQLQTVNENITRISTSIELKNTALEEEHGDLQQIRGKAKELETLLRGKRKRLDEVLSVY
EKRKDEHQSISKDFKSQEELISSLTTGLSTTEGHETGYSRKLHEARDTLNDFKAEKETNR
LKLEGLNKQISLTKPKKAEATKRCDQLNREIDILQNHVEKLKMSLKNTNSDITGEDVLQQ
KLKQLAKDRGNLLNELDALKSKLAYMEFTYTDPTPNFDRSKVKGLVAQLLTLNEENYDKQ
TALEITAGGRLYNLIVETEKIGAQLLQKGNLKRRVTIIPLNKITSFVASAERVGAAKKIS
NNKAQLALELIGYDDELLPAMQYVFGSTLVCDTPESAKKVTFHPSVKLKSVTLDGDVYDP
SGTLTGGSVNKSAGPLLQIQKLNSLQLKLQVVTSEYEKLETQLKDLKTQNANFHRLEQEI
QLKQHELTLLIEQRETDSSFRLLSDYQQYKDDVKDLKQRLPELDRLILQSDQAIKKIERD
MQEWKHNKGSKMAELEKEFNQYKHKLDEFTPILEKSENDYNGVKLECEQLEGELQNHQQS
LVQGESTTSLIKTEIAELELSLVNEEHNRKKLTELIEIESAKFSGLNKEIDSLSTSMKTF
ESEINNGELTIQKLNHEFDRLEREKSVAITAINHLEKENDWIDGQKQHFGKQGTIFDFHS
QNMRQCREQLHNLKPRFASMRKAINPKVMDMIDGVEKKEAKLRSMIKTIHRDKKKIQDTV
KSIDRFKRSALEKTWREVNSSFGEIFDELLPGNSAELQPPENKEFTDGLEIHVKIGSIWK
DSLAELSGGQRSLVALALIMSLLKYKPAPMYILDEIDAALDLSHTQNIGRLIKTKFKGSQ
FIIVSLKEGMFTNANRLFHVRFMDGSSVVQAR
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaggaactcatcattgatggtttcaaatcatatgctgtgcgaactgtcatt
agcaattgggatgaccaatttaatgctataacgggcctcaatgggtctggaaaaagtaat
atattagatgcaatatgctttgtcttgggaattacgaatatgtcgactgtccgtgcccag
aatttacaggacttaatttacaaacgcggacaggcaggaataaccagagctagcgttacc
attgtgtttaataatcgggatcctgcgtcttcaccaattggtttcgagaatcacccgcaa
gtaagcgttacaagacaaattatcatgggcggtacaagcaaatatttgattaatggacat
agagctctgcaacagaatgttcaaaatttgttccagtctgttcagttaaatattaataat
cctaattttttaattatgcaaggtcgaatcaccaaggttcttaatatgaaggctactgaa
attttatcaatgattgaagaagcctctggtactcgaatgtttgaagaaaggaaagaaaag
gcttttcgaacaatgcaacgaaaagaagcaaaggttgaggagattaatacactgttaaga
gaggaaatcgaaccccgacttaccaaacttcgtacagaaaaaaaaacttttctagaatat
caacatatttataatgacttggaacgattaagccatctttgtactgcttacgactattat
aagttgtcacttaaagtggaggaattaacggttcaagcatcccagaagcacagccatatc
gccgagatggaatcttcattacaaacatcgaaacaggaggttttaatactaaaggaaaag
attaaaaaaattgaagatgagcgaatgagacaaatgagtgtttcttcggatcgtaccttg
gactctcagttacaaactgttaatgaaaacatcaccagaataagcacgtcgatagaatta
aagaatacagctttagaggaagagcatggggaccttcaacaaattcgtggaaaagctaag
gaattagaaactttgttgcgcggaaaaaggaaacgactagatgaagtgcttagtgtatac
gaaaaaaggaaagatgaacatcaaagtatttcaaaggatttcaagtctcaagaagagcta
atttcatcacttacaactggtctttccactacagaaggtcatgaaactggctattctaga
aaactacacgaagctcgagatacgttgaatgactttaaagctgaaaaagaaaccaatcga
ttaaagcttgaaggactcaataaacaaatatctttaactaaacctaagaaggctgaggct
acaaaacgatgtgatcaactcaatcgcgaaatcgatatattacaaaaccatgttgagaag
cttaaaatgtctttaaaaaatacaaattccgacattacaggtgaagatgtactccagcaa
aagttgaagcaacttgctaaagatcgcggcaatttgttaaatgaacttgatgctttaaaa
agcaaacttgcttatatggaatttacttataccgaccctactcctaattttgatcgctca
aaggtgaaaggattggtggctcaattgctaaccttgaatgaagagaattatgacaagcaa
actgcattagaaattacagctggtggccgcctttataatctcattgttgaaaccgagaaa
attggtgcacaattgcttcaaaaaggaaacctgaagaggagagttactattattcccctc
aacaaaattaccagcttcgtagcttcagcagagagagtaggcgcagccaaaaaaatttct
aataataaagcccaacttgctttggaattaatcggttatgacgatgagcttttgcctgca
atgcagtatgtttttggctccacattagtctgtgatacccctgaatcggcaaagaaagtt
acctttcatccttcagttaaattaaaaagtgtcacgcttgatggtgatgtttatgaccca
tctggtacccttactggtgggtctgtgaataaatctgccggtcctttactacagatacaa
aagctgaacagtctgcagctaaaattgcaagtagttacttcagaatatgaaaagttggag
actcaacttaaagacttaaagactcaaaatgccaattttcatcgacttgagcaagaaatt
caactaaagcaacatgaattaacacttttgatagagcaaagagagaccgactcatctttt
cgtcttttatctgattatcagcagtacaaagacgacgttaaagatctcaagcaaaggctt
cctgaattagacagacttatattgcaaagtgaccaagctataaaaaaaattgaacgagac
atgcaagaatggaaacataacaagggatcaaaaatggctgaattggaaaaggagtttaat
caatacaagcacaagttagacgagtttactcctatattggaaaagtccgagaatgactat
aatggcgttaaactcgaatgtgaacaattagaaggcgaattgcaaaaccatcagcaatct
ctcgtacaaggtgaatcgaccacgagtttaataaagacggaaattgcagaacttgagctg
tcacttgttaatgaggagcataatcgaaagaaactcaccgaactaatagaaattgaaagc
gccaagttttctggacttaacaaagagatagattcactcagtacctcaatgaaaacattc
gaatctgaaataaacaatggggagctaacaattcaaaagctgaaccacgagtttgaccga
ttagagcgagaaaaatcagttgctataactgctattaatcatttggaaaaggaaaatgat
tggatagatggacagaaacagcactttggtaagcaaggaaccattttcgattttcactct
caaaacatgcgtcagtgtagagagcagttacataatttgaaaccgcgatttgctagtatg
cgtaaagctattaatcccaaggttatggacatgattgacggtgtagaaaagaaagaagcc
aaattgcgctctatgataaagaccattcatcgcgataagaaaaagatccaagatactgtc
aaaagtattgatcggtttaaaaggagtgccttagaaaaaacctggagagaagtcaattct
tctttcggtgaaatttttgacgaactacttcctggtaatagtgcagaactacagccacca
gagaataaagaattcactgatggattggaaattcatgtaaaaattgggtcaatttggaaa
gatagtctggcagaacttagtggtggacaaaggtctctagttgcattggctcttattatg
tctctacttaaatataagcctgctccaatgtacattttagatgaaattgacgcggcgctc
gatttaagtcatacccaaaacattggaagacttattaaaacaaagtttaaaggttctcag
tttattattgttagccttaaagaaggaatgtttaccaatgctaatcgactatttcatgta
cgatttatggacggatcatctgtggtacaagctcgctaa

DBGET integrated database retrieval system