KEGG   Schizosaccharomyces pombe (fission yeast): SPBP4H10.15
Entry
SPBP4H10.15       CDS       T00076                                 

Definition
(RefSeq) putative aconitase/ribosomal domain-containing protein
  KO
K02888  large subunit ribosomal protein L21
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPBP4H10.15
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spo03011]
    SPBP4H10.15
Ribosome [BR:spo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPBP4H10.15
  Bacteria
    SPBP4H10.15
SSDB
Motif
Pfam: Aconitase Aconitase_C Ribosomal_L21p AcnX
Other DBs
NCBI-GeneID: 2541348
NCBI-ProteinID: NP_596189
PomBase: SPBP4H10.15
UniProt: Q9P7D4
Position
II:join(2903085..2905816,2905857..2905881)
AA seq 918 aa
MATFARMKLCLSGSSQAIPSKGISLVAARFQSTASRASYVTPPYEKLMGKLQQVRKFLPG
QKLTLAEKVLYSHLVNPEESFSGVSPSDIRGSLYLKLNPDRVAMQDASAQMALLQFMTCG
LEKTMIPASIHCDHLIVGHRGANSDIPDSIANNKEIFDFLQSAAKKYGIQFWGPGSGIIH
QIVLENYAAPGGMMLGTDSHTPNAGGLGMIAIGVGGADAVDAMTNTPWELKAPKIIGVNL
TGAMSGWTTPKDLILHLAGKLTVRGGTGHIIEYFGPGVASLSCTGMATVCNMGAEVGATT
SIFPYTDSMRRYLIATHRAEVADAASEVHSEYNYLAADTGAKYDQIIDINLSELTPSLNG
PFTPDLSTPVSKFGEAIEKNKWPKKLSAGLIGSCTNSSYQDMTCVVDVVEQAISAGLKPK
VPFLVTPGSEQIRATIERDGITERLEEAGATVLANACGPCIGMWKRTDDIASGEPNAILT
SFNRNFRSRNDGNPSTMNFLTSPVIVAAKIFSSDLAFDPTHDTLQTPDGKAFKFRPPQGV
ELPSAGFIAGDSSYIPEPNPQPVPETEVTIDPKSDRLEALEPFEPYQGGEMENLKVAVKV
KGKCTTDHISAAGKWLKYKGHLSNICNNTLIGAMNAATGEVNRAYDNGKGMTIPELMWKW
KKDGQPWLVVAEHNYGEGSAREHAALQPRAMNGRIILTKSFARIHETNLKKQGVLPLTFV
NEADYEKIDAEDKVSTRGIEQLLEGVLDQPITLVVTKKDGSVVEIPCKHTMSKDQIEFFK
AGSALNLIREKAHSGVVNQKVIDSIKQQPDHYADAYIFNRHFVIAKGDQLGLPFHLKGVQ
VGDTIRLDKIASFGSRDFTLFGNPYVDPSLFTIEAVVLSFPKSALSVRVKHKRRHRHDRV
MKHKQTYTILRVTELKLN
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggctacattcgctagaatgaagctttgcctttcgggctcttcgcaggcaattccatcc
aaaggaattagtttggttgcagctcgattccaaagcactgcttcgagggcttcctatgtg
acaccgccatatgagaagttgatggggaaactccaacaagttcgcaagtttcttcctggt
caaaagctcactttggcggaaaaggtcctttattctcatttggttaaccctgaagagagc
ttcagtggtgtctctccttcagacattcgtggctccttgtacctcaaactgaatcccgat
cgtgtagccatgcaggatgcctctgctcaaatggccttgcttcagtttatgacgtgtggt
cttgaaaaaactatgattcccgctagcattcattgtgaccacttgattgttggtcatcgt
ggtgccaacagtgatatccccgatagcatcgccaataacaaggagatttttgattttttg
caaagtgccgctaaaaagtacggcatacagttttggggcccaggaagtggcattattcac
caaatcgtgctagaaaactatgccgctcctggtggaatgatgcttggaacagattctcat
actcccaacgctggtggtttgggtatgattgccattggcgttggtggtgccgatgccgtc
gatgctatgaccaatacaccatgggagttaaaagctcccaaaatcatcggtgtcaacctt
acgggcgctatgtctggctggactactccaaaagaccttatacttcatttggctggtaag
cttaccgttcgtggtggtaccggtcatattattgaatactttggccctggtgttgcgtcc
ctctcttgcactggtatggctactgtttgtaatatgggcgctgaagtcggtgcaaccacc
tcaatctttccttataccgattctatgcgtcgctatctaattgccacacaccgtgcagag
gtcgccgatgctgcgtcggaggttcatagtgaatacaactaccttgctgctgatactggg
gctaaatatgatcaaataattgacatcaacctttcggaacttaccccttccctcaatggt
cccttcactcctgatttgagcactcctgtttcaaaatttggtgaagccattgagaaaaac
aaatggcctaaaaagttgtcggctggccttatcggttcatgtaccaattcttcttaccaa
gatatgacttgtgttgtcgatgttgttgaacaagctatatctgctggacttaaaccaaag
gttccatttttggttacaccgggtagtgagcaaattcgcgcaaccattgaacgtgatggc
attactgaacgcttggaagaagctggcgctactgtgctggcaaacgcatgtggtccatgc
attggtatgtggaagcgtaccgatgacattgcttcaggcgagccaaatgctattcttaca
agtttcaatcgtaatttccgctctcgtaatgacggaaatccatcgactatgaacttcttg
accagtcccgtaattgtggctgccaagattttttcctctgatcttgcatttgatcccacg
catgatacattgcaaacacccgatggtaaagccttcaagtttagaccccctcagggcgtc
gagcttccttcggctggattcatcgctggtgactcttcctacattcctgagcctaatcct
cagcctgttccggaaaccgaagttacaatcgatcccaaatctgatcgtttggaggccctt
gaaccctttgagccttaccaaggaggagaaatggaaaaccttaaggttgcagtgaaggtc
aaggggaagtgtactaccgatcatatttctgccgctggtaaatggttaaaatacaaaggc
catcttagcaacatttgtaacaacacacttattggtgcaatgaatgctgctactggagaa
gtcaatcgtgcctatgacaatggcaaaggcatgacaattcctgagctgatgtggaagtgg
aagaaggatggacaaccttggttggtagtagctgaacataactatggtgagggttctgct
cgtgagcatgcagctttgcaaccccgtgccatgaatggtcgtattattttgaccaaatca
tttgcccgtattcatgagactaatttgaagaagcaaggcgttttgcctttaaccttcgtc
aatgaagccgactatgaaaagatagatgcagaggataaggtttccactcgtggtattgaa
caacttttagaaggtgttttggaccagcctattacccttgtcgtcactaagaaagacggt
tcagttgtagagattccttgcaaacacacaatgagtaaagaccagatagaatttttcaag
gccggttcagctcttaatttgattcgcgaaaaggcccattctggcgtggtaaatcaaaag
gttatagattcaataaaacaacaacctgaccactatgctgatgcgtatatatttaatcgt
cattttgttatagccaaaggagatcaactaggattgccttttcacttgaaaggtgtccag
gttggtgatacgatacgacttgataaaatcgcttccttcggctcaagagattttactctc
tttggtaacccgtatgtagacccttcattgtttacgattgaagcggttgtattatcattc
cctaaaagcgcattaagtgttcgagtaaaacacaagcgtcgtcatcgtcatgatcgtgta
atgaaacataaacaaacgtatactattttaagggttacggaactcaaactgaactaa

DBGET integrated database retrieval system