KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.12c
Entry
SPBP8B7.12c       CDS       T00076                                 

Gene name
fta3
Definition
(RefSeq) CENP-H-like protein Fta3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: CENP-H
Other DBs
NCBI-GeneID: 2541342
NCBI-ProteinID: NP_001342770
PomBase: SPBP8B7.12c
Position
II:complement(3654474..3655136)
AA seq 220 aa
MDNNDQISNLCLGALQLLADQPISVISNEPSEEQRNEHVLKKWENNVLRHWKILFSLFMQ
TCGDSVQGNAAFSILNFMTTNSLVGQLYQRLYDESNSLGFISSPLNETEHLSEENLKIES
SITFTSEEIEKEKENIKSVLLPSVQSISSSLELYASKESDYRSSIEGVLADLKLARARWE
IVRNVTQILLLESGISFLENKKLAYIMDLCGDREDNYSSY
NT seq 663 nt   +upstreamnt  +downstreamnt
atggataataacgaccaaatatcaaacctttgtctaggggctttacaactgcttgccgat
caacctatttcggttatctcgaatgaaccatctgaagaacagcggaatgagcacgtcctg
aaaaaatgggaaaataacgttttaagacattggaaaattcttttttctctttttatgcaa
acttgtggtgatagtgtacaaggaaatgctgccttctcaatcctcaatttcatgactact
aatagtttagtgggacaactatatcagcgactatatgatgagtctaattcattgggcttt
ataagtagccctttgaacgagacagaacatttgtcggaagaaaatttaaaaatcgaaagc
agtattaccttcactagtgaagaaattgagaaggaaaaagaaaatattaaatctgtatta
cttccttcagtgcaatctatttcttcttctttagaattgtatgcgtctaaagaatctgat
tatagaagctcaattgaaggtgtattagctgacttgaagttagcgcgtgcccgttgggaa
atcgttagaaacgtgacacaaatacttttgctcgaatccggcattagtttcctagagaac
aaaaaacttgcatatatcatggatctatgtggtgatcgtgaagacaattatagttcctat
taa

DBGET integrated database retrieval system