KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.14c
Entry
SPBP8B7.14c       CDS       T00076                                 
Symbol
dpb2
Name
(RefSeq) DNA polymerase epsilon catalytic subunit B Dpb2
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBP8B7.14c (dpb2)
   03410 Base excision repair
    SPBP8B7.14c (dpb2)
   03420 Nucleotide excision repair
    SPBP8B7.14c (dpb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBP8B7.14c (dpb2)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBP8B7.14c (dpb2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPBP8B7.14c (dpb2)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    SPBP8B7.14c (dpb2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      SPBP8B7.14c (dpb2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 2541347
NCBI-ProteinID: NP_596521
PomBase: SPBP8B7.14c
Ensembl: SPBP8B7.14c
UniProt: O94263
Position
II:complement(3656748..3658973)
AA seq 594 aa
MNNSITDSVEKKPEQVSFEVQPNALRPVAFHVFTRKYDLNINRDSLQELASFVSKKCGSQ
WRSQCEPLLDEIAKTWKRVHETQPIVTRPLLIPVLANLNVPHEVRVSSLARVQTLETTGS
FLNSSNSEIRETIKNEKYFRVLDAFKMPKFKYDSSRKVFVLSKQSPTLMASASACTDMLN
RRFNVVYSRILRNESFQTPSFSGSFSQTGTYQLTPIRNLLGRAGNTFLLFGLLTIAPDGT
LWLEDLDSQVQLDVSQAEQGFGLFCPGCLVLVNGQFLSSGLFLVFELGHPPIERRDASLK
ALNNLDILGLNMDAKQLALLRHAEQAYQSQAFVCISEVHLDNHQTFYALEKIFQKYESSE
AVPFCIILCGSFMSSAFHNSGSSIQYKEGFNKLAASLEKFPKICEKTKFIFVPGPNDPWT
TNGISLMPKHSIPLHFVNRIQRVCKHTIFASNPCRIIFFSQEVLIYRDDISGRFQRNSLK
FGKTPQGTSNINSIPLAEQQVHQQRKLVKTVLDQSHLSPFPSRTRPILWDFDYALSVFPL
PSCMGLIDSESSAFDVHYGGCPTFNPGALLLGVHYNWQEVFPVKKEIITHKERI
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgaacaattccattacggattcggtagaaaaaaaacctgaacaggttagttttgaagtt
caacccaatgcccttcgtccggttgctttccacgtatttaccaggaagtacgatctcaat
attaatcgtgactcactgcaggaattagcatctttcgtatctaaaaaatgcggctcacaa
tggcgttcccaatgtgagcccttactagacgaaattgcaaaaacttggaaacgagttcat
gaaactcaacctatagttactcgacctcttttgatccctgtcttggcaaatttaaatgtt
ccgcatgaagttcgcgtatcttccttagcaagagttcaaacgcttgagacaaccggttca
tttttaaattcgagtaattcggaaatccgtgaaactataaaaaatgagaaatactttaga
gtccttgatgcttttaaaatgcctaaatttaagtacgattcatcaagaaaggttttcgtt
ttatcaaaacagtctcctactttaatggcatctgcaagtgcctgcacagatatgcttaac
cgcagattcaatgttgtatatagccgtattttacgcaatgaatcttttcaaacaccttct
ttcagtggctctttctctcaaacaggtacatatcaattaactcctattcgcaatttatta
ggtcgagctggaaacacatttttgttgttcggactcttgactatagctcccgatggtacc
ttatggctggaagatcttgacagtcaagttcaactagacgtatcacaggcagaacaaggg
ttcggtctcttttgccctggctgcttggtacttgttaatggtcaatttctaagttctggg
ctatttttagtttttgagcttggtcatcctcccattgaacgccgtgatgcttccttgaag
gcccttaataatttagatattttggggttgaatatggatgcaaagcaacttgctcttctc
cgtcacgcggaacaggcatatcagtcacaagcttttgtttgtatcagcgaggttcatctt
gacaaccatcaaactttctatgcattagaaaaaatattccaaaaatatgaatcctctgaa
gctgtgccgttttgtataatattatgtggaagttttatgtcttccgctttccataattca
ggaagctcaattcaatataaagaaggatttaataagcttgcagcttctcttgagaagttt
ccaaaaatttgcgaaaagacaaaattcatatttgtccccggtccaaacgacccttggacg
acaaatgggatatccttaatgcctaagcattcaataccccttcatttcgtaaatcggatc
caacgcgtttgtaagcataccattttcgcttcaaacccttgccgcatcattttcttttct
caggaagtactaatttatagagacgatatatcaggaagatttcaaaggaattcattaaag
tttgggaagactccccaaggtacctccaatattaattctataccccttgcagaacaacaa
gtgcatcagcaaagaaaattggttaaaacagttttagatcagtctcacctttcaccgttt
ccatcgagaacacgaccaatattgtgggattttgattatgctttatcagttttcccgctt
cctagctgtatgggtctaatagattctgagtcgtcggcgtttgatgttcattatggaggt
tgcccaacttttaatcccggtgctcttttacttggcgttcactataattggcaagaagta
tttccagtaaaaaaagaaataattacacacaaggagagaatttag

DBGET integrated database retrieval system