KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.22
Entry
SPBP8B7.22        CDS       T00076                                 

Gene name
erd2
Definition
(RefSeq) putative HDEL receptor
  KO
K10949  ER lumen protein retaining receptor
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBP8B7.22 (erd2)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    SPBP8B7.22 (erd2)
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 2540214
NCBI-ProteinID: NP_596529
PomBase: SPBP8B7.22
UniProt: O94270
Position
II:join(3680026..3680047,3680085..3680210,3680266..3680756)
AA seq 212 aa
MTFFSALGDMAHLAAIFLLLHRMKKSKTCSGLSLKSHLLFLLVYVTRYLNLFWRYKSLYY
FLMRIVFIASESYICYLMLMTLRPTYDKRLDTFRTEYILGGCAVLALIYPTSYTISNILW
TFSIWLESVAILPQLFMLQRSGETESLTAHYLFAMCLYRGLYIPHWIYRIAVHKKVIGVA
ILAGIIQTVLYGDFAVVYRRTVLQGKKFRLPA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacatttttcagtgcactgggtgatatggcccatttggctgctattttcttgcttttg
caccgaatgaaaaaatcgaaaacctgttcaggactatctctcaaatcccatcttttgttt
ctgcttgtttatgttacacgttatttgaatctcttttggagatacaaaagcttgtattat
ttcttgatgaggatagtttttatagcttccgaatcctatatatgctacttgatgttaatg
actttgcgacctacatatgacaaacgtcttgatacttttcgaactgaatatatcttaggt
ggttgtgcagttctggctctcatttatccaaccagttataccattagtaacatcctatgg
acttttagtatttggttagaaagtgttgcaattctccctcaattgtttatgttacaacga
tctggtgaaacagagagcctgactgcccattacttatttgcaatgtgcttatatagagga
ctatatattcctcattggatttatcgtattgcagttcacaagaaagtcatcggtgttgca
attcttgcgggcattatccaaaccgttttgtatggtgattttgcagtcgtatatcgccga
acagttctacagggaaaaaagttccgattacctgcttag

DBGET integrated database retrieval system