KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.24cHelp
Entry
SPBP8B7.24c       CDS       T00076                                 

Gene name
atg8
Definition
(RefSeq) autophagy-associated protein Atg8
  KO
K08341  GABA(A) receptor-associated protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04136  Autophagy - other
spo04138  Autophagy - yeast
spo04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPBP8B7.24c (atg8)
   04136 Autophagy - other
    SPBP8B7.24c (atg8)
   04139 Mitophagy - yeast
    SPBP8B7.24c (atg8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBP8B7.24c (atg8)
   04121 Ubiquitin system [BR:spo04121]
    SPBP8B7.24c (atg8)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBP8B7.24c (atg8)
Membrane trafficking [BR:spo04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    SPBP8B7.24c (atg8)
Ubiquitin system [BR:spo04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   SPBP8B7.24c (atg8)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    SPBP8B7.24c (atg8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 2541386
NCBI-ProteinID: NP_596531
PomBase: SPBP8B7.24c
UniProt: O94272
Structure
PDB: 

Position
II:complement(join(3684653..3684928,3685095..3685150,3685232..3685265))
Genome map
AA seq 121 aa AA seqDB search
MRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQF
VYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVFP
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctcaattcaaggacgacttttcttttgagaaacgaaaaacagagtctcaaaga
atccgggaaaaatatcccgatcgaatacctgttatttgcgagaaagttgataaatctgat
attgctgcaatagataaaaagaaatatctcgttccatctgaccttacagttggtcaattt
gtatatgttattcgcaaacggataaaactttctcctgagaaggccatctttattttcatt
gatgaaatcttgcccccgacagcggccttgatgtcaacgatatacgaagagcataaaagt
gaggacggctttttgtatatcacgtattcaggagaaaatacatttggaacagtgtttcct
ttttag

DBGET integrated database retrieval system