KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.25
Entry
SPBP8B7.25        CDS       T00076                                 

Gene name
cyp4
Definition
(RefSeq) putative cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp4
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBP8B7.25 (cyp4)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPBP8B7.25 (cyp4)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPBP8B7.25 (cyp4)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 2541395
NCBI-ProteinID: NP_596532
PomBase: SPBP8B7.25
UniProt: O94273
Position
II:join(3685901..3686363,3686457..3686599)
AA seq 201 aa
MKLFYFSLLFTLFFGLISANRGPKVTDTVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFR
ALATGEKGFGYEGSIFHRVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGL
LSMANAGPDSNGSQFFITTVKTPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDV
KIIKSGQLSQENVEDDGTDEL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaagttgttctatttctctttactttttactcttttctttgggcttatctctgccaac
cgtggccccaaagttacagacacagtgtatttcgacttgcaacaaggtgatgagttcctt
ggaagagttaccattggattgtttggtaaaactgttcccaaaacagccgaaaatttccgc
gcattagccaccggagaaaagggatttggatatgaaggatctattttccatcgcgttatt
cccaatttcatgattcaaggtggtgatattacgaagggtgatggtactggtggaaaatca
atttatggcagccgttttcctgatgaaaactttaagctttctcaccaacgtcccggtttg
cttagcatggctaacgctggacccgattccaatggatctcagtttttcattactacagtt
aaaacaccttggttagatggacaccatgttgtttttggtgaagtcctttctggttacgat
attgtcaagaaaatttccaaagctgagactgacaaccgtgataagcctcttgaagatgta
aaaattatcaaatctgggcagttgtctcaagaaaatgttgaagatgacggaacagatgaa
ttgtaa

DBGET integrated database retrieval system