KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB10D8.02c
Entry
SPBPB10D8.02c     CDS       T00076                                 

Name
(RefSeq) putative arylsulfatase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Sulfatase Phosphodiest DUF4994 DUF4976 DUF229
Other DBs
NCBI-GeneID: 2541396
NCBI-ProteinID: NP_595046
PomBase: SPBPB10D8.02c
UniProt: Q9C0V7
Position
II:complement(83767..85431)
AA seq 554 aa
MAFNKQAESKKPNFLVIVADDLGWSDVSPFGSEIHTPNIERLAKEGVRLTNFHTASACSP
TRSMLLSGTDNHIAGLGQMAETVRRFSKVWGGKPGYEGYLNDRVAALPEILQEAGYYTTM
SGKWHLGLTPDRYPSKRGFKESFALLPGGGNHFAYEPGTRENPAVPFLPPLYTHNHDPVD
HKSLKNFYSSNYFAEKLIDQLKNREKSQSFFAYLPFTAPHWPLQSPKEYINKYRGRYSEG
PDVLRKNRLQAQKDLGLIPENVIPAPVDGMGTKSWDELTTEEKEFSARTMEVYAAMVELL
DLNIGRVIDYLKTIGELDNTFVIFMSDNGAEGSVLEAIPVLSTKPPVKYFDNSLENLGNY
NSFIWYGPRWAQAATAPSRLSKGFITEGGIRCPAIIRYPPLIKPDIISDEFVTVMDILPT
ILELAEVPHPGHKFQGRDVVIPRGKPWIDHFVHGKPVHKDTDFSGWELFGQRAIRKGNYK
AIYVPKEGIKTEWELYDLSQDKGELENLAKVHPDILNELIEYWLVYEAETGVVTAPDDFV
AENVGLFKPAKHNL
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggcttttaataaacaagctgaatctaaaaaaccaaactttttggtcatcgtagctgac
gatcttggatggtcagatgtttctccgtttggaagtgaaatacacactccaaatattgag
aggcttgcaaaggaaggtgtacggttgacaaactttcatacagcctctgcttgctcgcct
actcgatctatgttattaagcggtacagacaatcacatagcaggtttagggcaaatggca
gagacagtacgcaggttttcgaaagtatggggtggaaagcctgggtacgaaggctaccta
aatgatagagttgctgcattaccagagattctacaggaagcgggttactataccacaatg
tctggaaagtggcaccttggactaaccccagatcgttacccttcaaagcgaggatttaaa
gaatcttttgcacttttacctggaggtggtaatcattttgcatatgaacctggtactaga
gaaaaccctgctgtaccttttttaccaccattgtatacccacaatcatgatcctgttgat
cacaaaagcttaaaaaatttttattcgtccaattactttgcagaaaaattaattgatcag
ttaaaaaatcgtgaaaaatcccagtcattttttgcttacctcccatttacagcacctcat
tggccgttgcaatcaccaaaagaatatattaataaatatcgtggacgatatagtgaaggc
cccgatgtgttacgaaaaaatcgcttgcaagcccaaaaggatttgggacttataccagaa
aatgtaattccagcacctgtagatggaatgggaaccaagtcatgggacgaactaacaaca
gaagagaaagaattttctgcgcgaacgatggaagtttatgctgcaatggtcgaattatta
gatttgaatattggtcgtgttattgactacttgaaaactattggagaacttgacaacaca
tttgttatatttatgtcagacaacggtgcagaagggtcagttttggaagcaatcccggta
ttaagcacaaaaccaccggttaagtattttgacaattcactggaaaacttgggtaattat
aattcatttatttggtacggaccaagatgggcacaggctgcgaccgctccttctcgactt
agcaagggttttattacagaaggtggtattcgatgtcctgctataattcgctatcctcca
ttgatcaagccagacatcatctccgatgagtttgttacggttatggatatcctgccaacc
atccttgagttagcagaagtccctcacccagggcacaaatttcaaggacgagatgttgta
atcccccgtgggaaaccttggattgaccattttgtgcatggaaaacccgtacacaaagat
actgactttagcggctgggaacttttcgggcaaagagctatcagaaaaggaaattataag
gcaatatatgtacctaaagaaggaataaaaacagaatgggagctgtatgatctttcccag
gacaaaggtgagcttgaaaatctagcgaaagtccatccagatattctaaacgaactcatc
gagtattggttggtctacgaagctgaaactggagtagtaacagccccagacgattttgtt
gccgaaaacgtcggtttgttcaaaccagctaagcacaatctttaa

DBGET integrated database retrieval system