KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB2B2.02
Entry
SPBPB2B2.02       CDS       T00076                                 

Gene name
mug180
Definition
(RefSeq) putative esterase/lipase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Say1_Mug180 Abhydrolase_3
Other DBs
NCBI-GeneID: 2541394
NCBI-ProteinID: NP_596850
PomBase: SPBPB2B2.02
UniProt: Q9HDV1
Position
II:4460559..4461704
AA seq 381 aa
MISLSLLYRILTLPIILVGTTILYFTIGTNFPHDELRHNLLSTLFCSSMLHLSKGLTVKD
VRIFFHDSIGSTLLKNRKKLNSENELPNYGEKFTHKYDNQDMPDSVWLAKVNGMTKSDPI
ILHLHGGMMALPYDKVILVGLSNLYKLFSTTMNRPPSILLVDYSLVSQGYTYPKQVRECL
NVYQVLISKGFRNITVLGESAGGTLILSFLYQISELSKLNKVVWPKGVALISPWLDLTNA
KKIGSYRANDGLDVICYETLNRFGKAYVNNEESLFTSSVVNINMNCDISIWSKIPPIQDG
KVLVLFGENEVFRDEILSWTSKIGLLKAYPNRVLMDKQGIHIGLFLEESPSIGPGMTNLD
IWKKKFSVNSLYTFLRETFEE
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatatctttgtctctgttgtatagaatactgactttaccaataatattagtcggtaca
acaatattgtattttactataggaacaaattttccgcacgatgaacttcgtcataattta
ctgtcgactcttttctgttcttcaatgttacatttatccaaaggcttaactgttaaagat
gttcgaattttcttccatgattcgattggaagtactttgttaaaaaaccgaaaaaagcta
aattccgaaaatgagttacctaactatggcgaaaaatttactcacaaatatgataatcag
gatatgcccgattccgtatggctcgcaaaggttaatggaatgacaaaatcggatcctatt
attctgcacttgcatggtggaatgatggctcttccttatgacaaagtaattttggttggt
ttatctaatttatataaactattctcaacgacgatgaacagaccaccttctattttactg
gtggattattctttggtatctcaaggatacacatatcccaaacaagttagggaatgcctt
aacgtctatcaagtccttatatcaaaaggttttagaaatataactgtgttaggtgaatct
gcaggtggtacattgattttatcgtttttataccaaatttcagaattatccaaacttaac
aaagttgtttggcctaaaggtgttgctttaatttcaccttggttagatttgacaaatgct
aaaaagattggttcatacagggccaacgatggccttgatgtaatttgttatgaaactctg
aatcgattcggaaaagcctatgttaataatgaagagtcactatttacttcttctgttgta
aacatcaacatgaactgtgatataagcatttggagtaaaattcctcccattcaagacggg
aaagtacttgtgttgttcggggagaacgaagtgtttcgagatgaaatattgtcttggact
agtaaaattggcttattgaaagcttatcctaatagggttttaatggataaacagggaatc
cacataggcctttttttggaagaaagtccttcaattggacctggaatgacaaacttggat
atttggaaaaaaaagttctccgttaattctttatatacgtttttaagggaaacttttgaa
gaataa

DBGET integrated database retrieval system