KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB2B2.08
Entry
SPBPB2B2.08       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Other DBs
NCBI-GeneID: 2541397
NCBI-ProteinID: NP_596854
PomBase: SPBPB2B2.08
UniProt: Q9HDU7
Position
II:4476012..4476674
AA seq 220 aa
MIVQHKTAKIEEDHGLFQPILRPSDISKTTDTKFIQSSPYIEKEHWLDLGTLSVGHYFLS
LALQTFVPKDSVRYAHLPYAQAFDIAEIVNLIREYSHKYHKHIPAFSAYIVAFRSVLQPE
VQVSPEARHKLAEIDKGSHLEANVSGGLLKYWYGIPDDVFGQNLATCWWTSKESARLGGA
GKIHREGLKAVRGWYKNWKIEEYELEVIEGGSSYIFKGLS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgattgtacaacataaaacagcaaaaatagaagaagatcatggcttattccaaccaatc
ttgcgtccctcagatatcagcaaaacaactgatacgaaatttattcagtcttccccgtat
attgaaaaagagcattggctggacttgggaaccttaagtgtcggccattactttttatca
ctagctcttcagacttttgttcccaaagattctgtccgttatgcccatcttccttatgct
caagcctttgatattgcggaaattgtaaatttgatacgagaatattcacataaatatcac
aaacatattcctgccttttccgcgtatattgtagcatttcgttccgttttgcaacccgaa
gttcaagtttctccagaggcacgccataaattagcagaaattgataaaggatcgcatttg
gaagcaaacgtttctggtggcttattaaagtattggtatggtatacctgacgatgtattc
ggacaaaatttggctacatgctggtggacctccaaagaaagcgcaagactcggaggggca
gggaaaatacatagggaaggcttaaaagctgttcgtgggtggtacaaaaattggaaaatt
gaggaatatgagcttgaagtcattgaaggaggtagtagttacattttcaaaggtctttca
tag

DBGET integrated database retrieval system