KEGG   Schizosaccharomyces pombe (fission yeast): SPBPJ4664.04Help
Entry
SPBPJ4664.04      CDS       T00076                                 

Definition
(RefSeq) putative coatomer alpha subunit protein
  KO
K05236  coatomer subunit alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBPJ4664.04
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBPJ4664.04
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    SPBPJ4664.04
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBPJ4664.04
  Exosomal proteins of bladder cancer cells
   SPBPJ4664.04
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coatomer_WDAD COPI_C WD40 ANAPC4_WD40 Nup160 Phage_TAC_4 Prok-RING_1
Motif
Other DBs
NCBI-GeneID: 2541412
NCBI-ProteinID: NP_595279
PomBase: SPBPJ4664.04
UniProt: Q96WV5
Structure
PDB: 

Position
II:701890..705513
Genome map
AA seq 1207 aa AA seqDB search
MEMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIA
FHPTQPLFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIR
IWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMS
LEDQLAQAHNSISNDLFGSTDAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWR
MTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRDNDR
FWFITVHPKLNLFAAAHDSGVMVFKLERERPAHALNINTLLYVNKEKSIVSYDLLRAQST
TVASVKHLGSAWLPPRSLSYNPAEKVALLTSSADNGVYELVNVSSRSNSLPLKDNIKGPG
DDAIFVARNRFAVFSRSDQTIEIKDLSNKVTKTIQLPEKTRDIFFAGMGHVLLSTATQVH
LFDLQQKKIVSSFNANRVKYVVWSNDNSQAALLGKHYVYIVKKNLELITSIHETIRIKSA
VWVENNVLLYATLDHLKYALMSGDTGVIKTLESTLYLVKAKGNMVFALNRAAEPVSFEID
PTEYLFKLALLRKDYEQVLHLIQNSNLVGQAIIAYLQKKGYPEIALQFVEDPSTRFELAL
ECGNLETALELARTIDRPEVWSRLASDAMSYGNHKIAEITFQKLRYFEKLSFLYLITGNA
EKLQKMAIIAEKRNDTLSLFQNSLYLNEVESRINILEQAGMYPIAYLTAKSNGLEEKAQQ
ILSHCNKTEEEIKLPSLGSAFTTPVPVNETYTHNWPLLDTSHSTFEKSLQERMEQLAIER
QEEQESEEEYEEVEQSLMDVVDEMSDLAESVPEEEVDGWEVEDLAPEEAVNDVVDDASAF
VGADEIFLWKRNSPLAADHIAAGDFESAMKILNKQVGAINFSPLKTRFLEIYTASRVYLP
TISGLDPLVSYVRRNAETAERSQALPFITRNLASIKSHELHEAYRLVKANKILEAQICFR
SIIYLALTTVANSEEEADEISALIDECCRYIVALSCELERRRLGEEDTKRALELSYYFAS
ADLQPMHSIIALRLAINASHKLKNYKSASFLGNKLLQLAESGPAAEAANRAITLGDRNPH
DAFEIEYDPHVEMRICPKTLTPVYSGDDFDVCSVCGAVYHKGYVNEVCTVCDVGGIGQKG
TGRRFFA
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atggagatgctaacaaaatttgagtcgcgctcatctagagccaaaggcgtcgcatttcat
ccgacacagccttggattttgacgtcgttacacaatggaagaattcaactttgggactat
cgaatgggtacgcttttagatcggtttgatggccatgatggacctgtacgtggcattgca
tttcatcctacacaaccattatttgtgtcaggcggtgatgattataaagtgaacgtatgg
aattacaaatcaagaaaacttttattttcattatgtggacatatggactacgttcgtgtt
tgtaccttccatcatgaatatccatggattttgtcttgttccgatgatcagacgattcgt
atttggaattggcaatcccgcaactgtatcgctatattaactggccattctcactatgtt
atgtgtgctgcctttcatccttctgaggatctgattgttagtgccagtttggatcaaaca
gttcgcgtttgggacattagcggtcttcgcatgaagaatgcagctccggttagtatgtcg
cttgaagatcagctagctcaggcccacaactcgatttctaatgacttatttggtagcaca
gatgctatcgtaaaatttgttttagaaggtcatgatcgaggcgtgaactggtgcgctttc
catccaactcttcctttaatcctctctgctggcgatgatcgacttgtaaaattatggcgt
atgactgcttctaaagcttgggaggttgatacgtgtcgtggccattttaataatgtttct
tgctgcttgttccacccacatcaagagctcatattgtcagccagtgaagacaaaactatt
cgtgtttgggatttgaatagaagaaccgccgttcaaactttccgtcgcgataacgaccgt
ttttggtttattactgttcatcccaaattgaatttatttgcagctgctcatgatagtggt
gttatggttttcaagctggaacgtgagcgccctgcacatgcgcttaatatcaatactctt
ctttatgtcaataaggagaagtcaattgtttcttatgatcttttacgcgcacaaagtact
actgtcgcttctgttaagcacttgggaagcgcatggctacctcctcgttctttgtcttac
aaccccgctgagaaagttgctcttcttacttcttctgctgataatggcgtttatgaactt
gttaatgtatcatcacggtctaattccttgcctttgaaggataacattaagggtcccgga
gatgatgcgatttttgtagcacgtaatcgttttgctgtcttttctcgaagcgaccaaacc
atcgagattaaggatctttcgaataaagttacaaagaccattcagcttcctgagaaaaca
agagacattttctttgctggaatgggtcatgtgctcttatctaccgctacccaagttcat
ttgtttgatcttcaacaaaagaaaattgtttcatcttttaatgccaaccgcgtaaagtat
gttgtatggtcaaatgataattcgcaggctgctctattaggaaagcattacgtgtacatt
gtgaagaaaaacttggaattaattacctctattcatgaaaccattcgcattaaaagtgct
gtttgggtagagaataacgttttactttatgctactttagaccatcttaaatatgcatta
atgtctggtgatacaggtgtcataaaaactctggaatctactttgtatttggtcaaagca
aaaggaaatatggtttttgctctcaatcgtgctgctgaacccgttagttttgaaatagat
cccactgaatatttgttcaaattagccttgttaagaaaggattacgaacaagttcttcat
ttaattcaaaattctaacctcgttggtcaggctattatagcttatcttcagaagaagggt
tatcctgaaatcgctttacaattcgttgaggatccatccacccgatttgaattggcatta
gagtgcggaaacttggaaactgctttagagcttgcccgtacgattgaccgacctgaggtt
tggtctcgtttagcttccgacgctatgtcttatggcaaccacaaaattgcagaaattacc
tttcagaaactccgttattttgaaaaactttctttcctttatttgattactggcaatgct
gagaagcttcaaaaaatggcaataattgccgaaaaaaggaatgataccctaagtctgttt
caaaacagtctctatttaaatgaagtggaatctcgtataaatatcttagagcaggctgga
atgtatcctatcgcttatcttaccgcaaaatctaacggtcttgaagagaaagcccagcaa
atactatcacattgcaataagactgaagaggaaattaaattgccatctctcggttcagca
ttcacgactcctgtacccgttaacgaaacatacacccataattggcctttgctcgacacc
tctcattctaccttcgaaaaatcactacaagagaggatggagcaacttgcaattgaaaga
caagaggaacaagaatctgaagaagagtatgaagaagttgagcaaagtcttatggatgtt
gttgatgaaatgagtgatttggcagaaagcgttccagaggaggaagttgatggatgggag
gtcgaagatttggctcctgaagaagctgttaacgatgtagttgatgacgcatctgcattt
gtcggtgcggacgaaattttcttgtggaaaaggaattccccattggcagccgatcatatt
gctgccggtgattttgaaagtgctatgaagattttaaacaagcaagttggagccatcaac
ttttctcctttgaaaactcgatttttagaaatatacactgcctcccgcgtatatttacct
actataagcggcttagatcctttagtttcttatgttcgtagaaacgctgagactgcggaa
cgttcacaagccttgccattcattaccaggaatcttgcatctattaaatcgcacgaactt
cacgaagcgtaccgtttggtgaaagctaataagattctggaggcacaaatttgcttccgt
agtatcatttacttggccttaactaccgtagcaaattcggaggaagaagcagatgaaatt
tctgctttaatagatgaatgctgtagatatatagtggcattatcgtgcgagttggagcgt
cgacgtttgggagaagaggatacaaagcgtgcactcgagctttcttattactttgcttct
gcggacttgcaacctatgcactccatcatcgccctacggttggcaattaatgcttcacat
aagctgaaaaattacaaatccgcatcgtttttgggaaataagctattgcaacttgctgaa
agtggtcctgcagctgaagcagccaaccgcgccattaccttaggtgaccgaaaccctcat
gatgcctttgaaatcgaatatgatccacacgttgaaatgcgtatttgtcccaagacttta
actcctgtatattctggagatgattttgatgtttgttccgtttgcggtgccgtatatcat
aaaggctatgtcaatgaagtttgtacggtatgtgatgtcggtggtatcggtcaaaaaggt
actggtagaagattctttgcataa

DBGET integrated database retrieval system