KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1183.06
Entry
SPCC1183.06       CDS       T00076                                 
Symbol
ung1
Name
(RefSeq) uracil DNA N-glycosylase Ung1
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SPCC1183.06 (ung1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC1183.06 (ung1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SPCC1183.06 (ung1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SPCC1183.06 (ung1)
 Prokaryotic type
     SPCC1183.06 (ung1)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 2538855
NCBI-ProteinID: NP_587889
PomBase: SPCC1183.06
UniProt: O74834
Position
III:603006..604420
AA seq 322 aa
MTVLNTTDKRKADDTVNKLDGKLKQPRLDNFFKTNTSSPALKDTQVLDNKENNSVSKFNK
EKWAENLTPAQRKLLQLEIDTLESSWFDALKDEFLKPYFLNLKEFLMKEWQSQRVFPPKE
DIYSWSHHTPLHKTKVILLGQDPYHNIGQAHGLCFSVRPGIPCPPSLVNIYKAIKIDYPD
FVIPKTGYLVPWADQGILMLNASLTVRAHQAASHSGKGWETFTSAVLQVALNRNRKGLVI
LAWGTPAAKRLQGLPLKAHYVLRSVHPSPLSAHRGFFECHHFKKTNEWLEEQYGPEKCIN
WSAVSEQKAKIKSSELESSSTE
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactgttctgaatactacagataagcgtaaagctgatgataccgttaataaacttgac
gggaaattaaagcagccacgtttggataatttttttaagacaaacacctcatcgcctgct
ttaaaggatactcaggtacttgataataaagagaacaactctgtctcaaagttcaataaa
gaaaaatgggcagaaaatcttactcctgctcaaagaaagctgttacaactagaaattgat
actttggagagttcttggtttgatgcgttaaaagatgaatttttaaagccatattttttg
aatctgaaagagtttttgatgaaggaatggcaaagccaacgtgtattcccgccgaaagaa
gatatctactcatggtcacatcatactccacttcataaaaccaaggtcattctcttagga
caagatccttaccataacattggtcaagcccatggtctttgcttttccgtacgtccagga
attccatgtccaccaagtttggtcaacatatataaagccatcaagatcgattatcctgat
tttgttattccgaaaacagggtatttagttccttgggctgaccaaggcattttaatgctc
aacgctagtttaactgtaagagcccatcaagctgcttctcattctggcaagggttgggaa
actttcacttctgctgtcctgcaagttgcgttgaatcggaatcgcaagggtcttgtaatt
ttagcatggggaactccagcagctaagcgacttcaaggtcttcctttgaaagcacactat
gtacttagaagtgtccatcctagccctctctctgcacatcgtggcttttttgaatgccac
catttcaagaaaaccaatgagtggctcgaagagcagtatggacctgaaaaatgcatcaat
tggagcgctgtttctgaacaaaaagcaaaaataaagtctagcgagttggaatcctcttca
actgagtag

DBGET integrated database retrieval system