KEGG   Schizosaccharomyces pombe (fission yeast): SPCC11E10.05cHelp
Entry
SPCC11E10.05c     CDS       T00076                                 

Gene name
ynd1
Definition
(RefSeq) nucleoside diphosphatase Ynd1
  KO
K14642  golgi apyrase [EC:3.6.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00240  Pyrimidine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPCC11E10.05c (ynd1)
   00240 Pyrimidine metabolism
    SPCC11E10.05c (ynd1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     SPCC11E10.05c (ynd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDA1_CD39 OppC_N
Motif
Other DBs
NCBI-GeneID: 2538741
NCBI-ProteinID: NP_588201
PomBase: SPCC11E10.05c
UniProt: Q9USP2
Position
III:complement(1460509..1462227)
Genome map
AA seq 572 aa AA seqDB search
MVRKYGIFIDAGSSGSRLLIYSWDYDTDSSLSDKVKKLPLIETGIGDGGKWSLKVQPGIS
SFANNPKHVGKKHLKELLDFAAHAIPKDVHKETPVFLSATAGMRLLGVDAQNKILSHACR
YIKKNYDFDIPNCSNSIRVIDGKAEGMYGWLATNYLLKTLEEKDTSTVGFLDMGGASVQI
AFELPPSQLKNYKDSISTVHIGLQNGQQLEYPLFVTTWLGFGANEAYRRYLGLLIESENG
KVGNTLSDPCSLRGRTYDIDGIEFAGTGDLKQCLKLTYNLLNKDKPCSMDPCNFDGISIP
PVDFANTEFVGVSEFWYTTNDVFDMGGSYHFPNFYKKVDEYCGTEWETMLSRLYNKELTP
STDENKLEKLCFKASWALNVLHEGFDVPKSNTSSNDAKDGLSVIPAYHSPFTSLEKIERT
EVSWTLGQVLLYASNQQLLAKPEYANYYMDPYGKLIASPSKHWMRLFPNKLFFILSFIFC
LFFLFSLVLFGYDPKRRQRFKKFLLRLQRRKAPYIMSANGSYEDIADFSDDLEMSSPSKW
HGPPIRTTSSHVLADRLSFTASRERTPRSPFP
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaaagtatggaattttcatcgacgctggatctagtggttcaagacttctaatt
tattcttgggactatgataccgattcctctttaagtgataaagtaaaaaaattaccatta
atcgagacagggattggggatggtggtaaatggtctttaaaggttcaacctggaatttct
tcctttgccaataaccctaagcatgtagggaagaagcatttgaaagaactcctggatttt
gctgctcatgctattcccaaagatgtacataaagaaactccggttttcctaagtgctaca
gctggtatgcgtttactgggcgttgatgcccaaaacaaaatactttcgcatgcttgtaga
tatattaaaaagaattacgatttcgacatacctaattgctcaaattcaatccgtgtaatt
gatggcaaagctgaaggtatgtatggttggctagctacgaactatctccttaagacactt
gaagaaaaagatacgtcaacggttggttttttagatatgggcggtgcgagtgtgcaaatt
gcttttgaacttcccccatctcagctcaaaaattacaaggatagtatttcgaccgttcac
ataggactacaaaatggtcagcaattggaatatcctttgtttgttactacctggctcggt
tttggcgctaatgaagcttaccgcaggtatttgggactgttaatagaaagcgaaaacgga
aaagttggcaacactttaagcgatccgtgttccttgcgtggacgaacttatgatatcgat
gggatcgaatttgccggtactggagatttgaaacaatgcttgaaactgacttacaatcta
ttaaataaagacaagccatgctccatggacccttgtaactttgatggaatatctattcct
cctgttgattttgcaaatactgaatttgttggggtctcggaattttggtatacgactaat
gatgtgtttgatatgggcggtagctatcatttccctaatttttacaaaaaagttgacgag
tattgtggtacagagtgggaaaccatgctttcccgtctttataataaagagctgactcca
agtactgatgaaaacaagcttgaaaagctttgttttaaagcatcatgggcgttgaatgtc
cttcatgaaggattcgacgttcccaagtcaaatacaagtagtaatgatgcaaaggatggg
ctctcggtaattcctgcgtaccattctccattcacgagtttagaaaaaatagaacgcacc
gaagtgagctggaccttaggccaagtattgctttatgcatcaaatcagcaacttctagca
aaaccggaatatgctaattattatatggacccatacggaaagctaatcgcatccccttca
aaacattggatgaggttatttcctaataaattgttctttattctttcatttattttctgc
ttattctttctgttctctttggttttgttcgggtatgatccgaaaaggcgccaacgtttc
aaaaaattccttctgcgcttgcaacgtcgcaaggctccgtacattatgtctgcaaatgga
agttatgaggatatagcagatttttctgatgatttagaaatgagcagtccctctaagtgg
catggacccccgatacgtaccacttcaagccatgttctcgcagacagactttcgtttact
gctagtcgagagagaacgcctagatccccttttccttaa

DBGET integrated database retrieval system