KEGG   Schizosaccharomyces pombe (fission yeast): SPCC11E10.07c
Entry
SPCC11E10.07c     CDS       T00076                                 
Name
(RefSeq) putative translation initiation factor eIF2B alpha subunit
  KO
K03239  translation initiation factor eIF-2B subunit alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spo03012]
    SPCC11E10.07c
Translation factors [BR:spo03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    SPCC11E10.07c
SSDB
Motif
Pfam: IF-2B
Other DBs
NCBI-GeneID: 2539154
NCBI-ProteinID: NP_588203
PomBase: SPCC11E10.07c
Ensembl: SPCC11E10.07c
UniProt: Q9USP0
Structure
Position
III:complement(1464630..1466268)
AA seq 341 aa
MVESDSSGIVRHSQGEFDIVQVYKKFLQDDPEITMPVAAIEALVQLLSRSQAKTISEFMD
ILQNGSNTLKEGVQNNISLSAGCDIFQRFVTRSLHDVGDFEQCKRHLVENGKLFIQRARA
CRQRIAHLGYPLIRDGSVILTHGFSRGVAAVLLAAAKRHVRFKVFVTESRPSGSGCLMTR
TLKNACIPTCMVLDSAVSFTMNRVDLVLVGAEGVVENGGLINQIGTFQLAVFAKHAHKPF
YAVAESHKFVRMFPLSQYDIPFSRPILEFDDPSPETVHPEPEPIPTPSDAIHNELIMNEE
QIRNNPTLDVTPPEFVSGLITDLGIIDSKSGVSEELIKLYL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggtggaatcggattcttcgggaatcgttcgacattctcaaggagaatttgacatcgtc
caggtttacaaaaaatttttgcaagatgatccagaaatcacgatgcctgtagccgccatt
gaggctttagtccagcttttgtcgcgctctcaagccaagacaatttcagaatttatggac
attttacaaaatggctcaaatacgctgaaggaaggcgttcaaaacaacatttcgctttca
gctggttgtgacattttccaacggtttgtcactcgatcactacacgatgtcggggatttt
gagcaatgcaaacgtcacttggtagaaaatggaaaactctttattcagcgtgctcgtgct
tgtcgacaaagaattgcacatttaggttaccctcttattcgagatggtagtgttattctt
acccatgggttttcacgcggtgttgcggctgttcttttggctgctgccaagcgtcacgtt
cgtttcaaagtttttgtcacagaatcaagacctagcggctcaggctgtctaatgacgaga
acattaaaaaatgcttgtattcctacttgcatggttttggattccgctgtaagctttact
atgaaccgtgtagatttggtcttggttggcgcagaaggtgttgtcgaaaacggaggactc
attaatcaaatcggtactttccaacttgccgtttttgccaaacatgcacataagcccttt
tacgcagttgcagaaagtcataaattcgtgcgtatgtttcccctttctcaatatgatatt
ccctttagtcgtcctattctggaatttgatgatccatctcctgaaactgttcatcctgaa
cctgaaccaattccaactccatcagatgctattcataacgagctgatcatgaatgaagaa
caaattcgaaataatcctactttggatgttacaccacccgaatttgtctcaggtctcatt
accgatttagggatcattgattcgaagagtggggtaagcgaagagctaattaaattgtat
ctttag

DBGET integrated database retrieval system