KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1223.07cHelp
Entry
SPCC1223.07c      CDS       T00076                                 

Gene name
drs1
Definition
(RefSeq) putative aspartate--tRNA (Asp) ligase Drs1
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Module
spo_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPCC1223.07c (drs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPCC1223.07c (drs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPCC1223.07c (drs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     SPCC1223.07c (drs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SPCC1223.07c (drs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPCC1223.07c (drs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 2539278
NCBI-ProteinID: NP_588352
PomBase: SPCC1223.07c
UniProt: O74407
Position
III:complement(join(1852712..1854377,1854436..1854512))
Genome map
AA seq 580 aa AA seqDB search
MSEMEKQVENLSLEAKNEKPKEVILGEDGKPLSKKALKKLEKEREKEQKRKEREAREAEE
KKKREANEIDYSAGKYGDLPLNRSTARPGRTYTQISDISAKNDGQTVLLRARVYTSRLQG
NKMCFFSLRQKYDTIQALAVVNKDTISKQMVKWCGSISLESIVLVEGIVKKSPEIIKSAT
VQDAEIHISSIYVISPIKKNLPFLVEDAGRSEEQIRESEENAAEGDSKFVRVNLDTRLDN
RVLDLRTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGASSEGGSNVFKIQYFKT
DGFLSQSPQLYKQMLIAADRERVFEIGPVFRAEDSNTYRHMTEFTGLDLEMAFNEHYHEV
MEFIEKLFLYIFKTIREKYAKQVAVVRQQYPSEDFILPDADRIRFHFKDAVKLLKEAGYR
KQLVPGQKVPEDEEFHYCEDPEFDDFSTPEERALGQIVREKYHTDFYVIDKYPSSVRPFY
TMPDPEDPRYSNSYDFFMKGQEIMSGAQRIHDPELLVERMKALGVSPDVGLQQYIDAFAI
GCPPHAGGGIGLERVVMFYLNLPNIRLASSFPRDPKRLLP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatggaaaaacaggtagaaaatctttctttagaggctaagaacgaaaagcca
aaagaggttattcttggtgaggatggaaaacctctttccaaaaaggctttgaagaaactt
gaaaaagaacgtgagaaggaacaaaagagaaaagaaagagaggctcgtgaggccgaggag
aagaagaagcgtgaagccaacgaaattgactactctgctggaaaatacggtgatttacct
ttaaacagatctactgctaggcctggtcgtacatatactcaaatttccgacatttctgct
aaaaacgatgggcaaactgttttgctcagagctagagtttacacttctcgtttacagggt
aacaagatgtgcttcttttctttgagacagaaatacgacactattcaagccttggctgtc
gtcaacaaggatactattagcaagcaaatggtgaagtggtgtggcagtatcagtttggaa
tcgatcgttcttgtcgaaggtatcgtcaagaagagtcccgaaatcatcaagagtgctact
gttcaggatgctgaaattcacattagctctatctatgtcatttctcccattaaaaagaac
cttccttttcttgttgaagatgctggccgttctgaagagcaaatcagagaatctgaagaa
aatgctgctgagggagattccaaatttgttcgtgtcaatcttgatacacgtttggacaat
cgtgtacttgatcttcgtactcctaccaaccaagccatttttgacattcaagccggtatt
tgccaagctttccgtgaatttttgttatctaatagctttaacgagattcatacgcccaag
atgagtggagcttctagtgaaggtggctcaaatgtttttaaaattcaatactttaaaaca
gatggatttttgtcccaatccccccagctttacaagcaaatgcttattgctgctgatcgt
gagcgtgtttttgaaattggacctgtgtttcgtgccgaagactccaacacttaccgtcat
atgaccgaatttactggtcttgatttggagatggctttcaacgagcactatcatgaagtc
atggaattcatagagaagttatttttgtacattttcaaaactatccgtgagaaatatgcc
aaacaggttgctgtcgttcgtcagcaatatccctccgaagacttcattttgcctgacgct
gatcgcattcgcttccatttcaaggacgctgttaagcttttgaaggaagctggctatcgt
aaacaattagttccaggacaaaaggttcctgaagacgaagaatttcattactgcgaggat
cccgaatttgatgattttagcacaccggaggaacgtgctttgggtcaaatagttcgtgag
aagtatcataccgacttctacgttattgataaataccccagtagcgtccgtcctttctac
actatgcctgatcctgaagatcctagatattctaacagttacgatttcttcatgaagggt
caagaaatcatgtccggtgctcaacgtattcatgatcccgagttgttagttgaacgcatg
aaagctctcggtgtatcacccgatgttggccttcaacaatacattgatgcattcgctatt
ggatgtcctcctcatgctggtggtggcattggtttggaacgtgtagttatgttttatctc
aatctcccgaatattcgtcttgccagctcattccctcgtgatccaaagcgtttgcttcct
tag

DBGET integrated database retrieval system