KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1223.10c
Entry
SPCC1223.10c      CDS       T00076                                 
Symbol
eaf1
Name
(RefSeq) RNA polymerase II transcription elongation factor SpEAF
  KO
K15186  ELL-associated factor
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPCC1223.10c (eaf1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     SPCC1223.10c (eaf1)
SSDB
Motif
Pfam: EAF DUF5974
Other DBs
NCBI-GeneID: 2539104
NCBI-ProteinID: NP_001343024
PomBase: SPCC1223.10c
Ensembl: SPCC1223.10c
Position
III:complement(1860094..1862041)
AA seq 251 aa
MNSLQKGSYKVIPGSSFSKNSNGLLSIKYNFIPESVDPSRRGVLEKAQEAYRLRLPSTFD
DDRPHIFEGSCQRARNVDCVLIFNAKTKTFTLEHIDEIARLNALRNPKVSKTVPSNAITQ
SDNSQISESKSTSQSAVTTNSTRRKEKELEASKDGKIKPSSSNTRYPAISSKGPITTDTN
DEPDMEVMELDDFAKELELGFDQEFNSIDDPSTVSQTASKPISLRGLSSQERDYASSAQA
EGISSASEDED
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaattcattacagaagggatcatacaaagttattcccgggtccagcttctcaaagaat
tcaaatggacttttatctattaaatacaattttataccagaaagtgtggacccttctcgt
cgaggtgttttagaaaaggctcaggaagcctatcgtctacgtcttccttcaacttttgat
gatgacaggcctcatatatttgaaggctcatgccaacgagccaggaatgtggactgtgta
ctaatttttaacgctaaaacaaagacattcacactggagcatattgatgagattgctcga
ttaaatgctttacgcaatccaaaagtctctaaaactgtaccttctaatgccatcactcaa
tctgataattcccaaatctctgaatccaaatcgacctctcaaagtgcggtcacgactaat
tccacgagacgtaaagaaaaggaattggaagcttcaaaggatggaaaaataaaaccttca
tcgagcaatactcgatatcctgccatatctagcaagggaccaatcaccaccgataccaac
gatgagcctgacatggaggtcatggagttggatgactttgccaaagagttagagctagga
tttgatcaggaatttaattccatagacgacccctctacagtatcccaaacggccagcaaa
ccaatctctttgaggggtctatcttcgcaagagagggattatgcttcttctgctcaggca
gagggtatcagcagcgcttccgaggatgaggattaa

DBGET integrated database retrieval system