KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1223.15c
Entry
SPCC1223.15c      CDS       T00076                                 
Symbol
spc19
Name
(RefSeq) DASH complex subunit Spc19
  KO
K11572  DASH complex subunit SPC19
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1223.15c (spc19)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    DASH complex
     SPCC1223.15c (spc19)
SSDB
Motif
Pfam: DASH_Spc19 STAT_alpha Glycohydro_20b2 AviRa Streptin-Immun
Other DBs
NCBI-GeneID: 5802726
NCBI-ProteinID: NP_001343012
PomBase: SPCC1223.15c
Ensembl: SPCC1223.15c
Position
III:complement(<1846215..>1846762)
AA seq 152 aa
MSYLDGLQQCVDSLQISIGTLSSSIDTLESGIHDFPRIKHILKVQRHFNLISEDELSARQ
AKFEEIVKPILSKAFQRLEDSISSLQRQEDSLKTKYELQEARLDMLKNRPATSAFSVTTE
SSEQLKAIIAKRQKLVYTLERYTLQLQQKRGH
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgtatttggatggattgcagcaatgcgttgattctttacaaattagtattggaaca
ctttcatcaagcatcgatacactagagtcgggaattcacgactttccccggattaagcat
attttaaaggttcaaagacattttaatcttatttctgaagacgaactcagcgcacgccaa
gctaaattcgaagaaatagtgaaacccattttgtcaaaggcatttcaacgattggaagac
tctatttcaagcttacagagacaagaggattcgcttaaaacaaaatacgagcttcaggaa
gctcggttggatatgctaaaaaatcgacctgccaccagcgccttttcagtaaccacggag
agttcagaacaattgaaagcaattattgcgaagcgtcaaaaattggtgtatactctagaa
cgatacacgcttcaactacaacaaaaacgaggtcattaa

DBGET integrated database retrieval system