KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1235.05c
Entry
SPCC1235.05c      CDS       T00076                                 

Gene name
fft2
Definition
(RefSeq) putative protein Fft2
  KO
K14439  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1235.05c (fft2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPCC1235.05c (fft2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    SPCC1235.05c (fft2)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII ERCC3_RAD25_C
Other DBs
NCBI-GeneID: 2539045
NCBI-ProteinID: NP_587731
PomBase: SPCC1235.05c
UniProt: O74842
Position
III:complement(183023..186877)
AA seq 1284 aa
MLPYNSNYLSDNGKRKFSDENPQSEVYGSSQTGLPSSYGNPQSYGTPPVQQSSAMYGVNN
SMGGGMYNTSENTQFMNTDYSQTSSYASTPMSNAYSRDAPAAINNNFGYSYVGQSSQPVP
SYNPLPSYNTASLPNAGIPAAMPGMPSGYPGTVPIPQGGYNAHYSSPYNNGYPIGAVNPT
SAIPAQPPAQPVNNVLPSYVRSNSRSSARSTARSAPRSTQRSRSSSANPVTTPPVNNTLL
TPPAPPVELPPVTTTSPNAIIRSVQWIRSFVPQAPIHQVINTLAQTKWDETAALSILSQK
YLSCDLGIPIQEHKRFKQSPVASNMPTYGSSNRTVQSQKRSIRDKYIQMPNDSTQASLMP
SYTRKTSNASKKLTTEEDEFYDSEEEPEAIVHRDTSALERTVLNFINSSTAKELSDTASC
PLSHSKLLLEHRPFQTLAEACIIKHPDDVPSKPGRRGRRREKNPMGQKIVNACMETMEGY
YAIDNLIAKCEFLGNRISKGMASWGIKLEMSNGELNIVDMESVPTEAADNSDFPKFVTEQ
PKTLASDVQLKSYQLVGVNWLHLLYQQKLSGILADEMGLGKTCQVVAFFALLLEQGHHGP
HLVVVPSSTLENWLRELARFCPSLRVEPYYGSQQERANIREAIEENEIKYDILVTTYQLA
TNNKEDRSFLKHQNFDVCVYDEGHYLKNRMSERYKHLMNLNANFRLLLTGTPLQNNLKEL
VSLLAFILPNMFDSDMDDLDVIFKAKPTADADIEQALLSKQRISRAKTMMTPFVLRRRKN
QVLNDLPKKTQIIEHCKLSENQLEIYNRYAALQKNQQLRRDDKRNKRSKNDEESDGKSLS
AGHVLMQLRKAANHALLFRKFYDDEKLKQMAKDIMQEEQYKNANEQYIYEDMEVMSDFEL
HRLCRSFPTLQSYTLKDDPWMDSGKIRVLKELLPKMKEEGSRILLFSQFTQMLDILEQVL
DTLKISYVRLDGSTQVEVRQDIIDQFHKEEDVTVFLLSTKAGGFGINLACANVVILYDCS
YNPFDDLQAEDRAHRVGQVREVTVIRLITDNTIEEYIQKLANTKLALDMSLSSDGKDREE
IGERLVQDMLDEENNGNNTKPEITGNESDGEFKVSSSNNSKQTDAEETNTGVPLEGSQPN
SVEKTDLADGDEKANIKTEMKSETVEGDNKELRETMKGENVQTDSNAAVPSSKSSTEEPN
ESVLSGHLDLDTEASPVVSTIEKTTKGDVSVTEEQQSANIDGQLEKPEIEESKKPDVLNQ
VSLSIEEEKPKNKESEVDNNAAKD
NT seq 3855 nt   +upstreamnt  +downstreamnt
atgcttccttacaattcaaattacttatcggacaacgggaaacgaaagttttccgacgaa
aatcctcaatcggaagtttatggttcttcgcaaacaggtttgccttcttcatacggaaat
cctcaaagctatggtacgccccctgtccaacagtcttccgctatgtacggggtgaataat
tccatgggtggtggaatgtataatacttctgagaacactcaatttatgaatactgattat
tcgcaaacttcttcgtatgcgtcgactccaatgtccaatgcttattccagagatgctccc
gctgcaatcaacaacaattttggttattcatacgtgggacaatcatcgcagccagtccct
tcttataaccccctgccctcttacaatactgcgtctttgcccaatgctggaattcccgca
gcaatgcctggtatgccatctggttatccaggcactgttccaatacctcagggtggttat
aatgcacattatagttccccttataataacggctatcctatcggtgctgtcaatcctaca
tcggcaatacccgcgcagcctccagcacaacccgtcaataatgttttacccagctacgtt
cgttcaaactcgcgctcatctgcacgctccacagcgcgttctgctccacgctctactcag
cgatctcgttcctcctccgcaaatcccgtgactaccccaccagtcaacaataccttgctt
acacctcccgctccacctgtcgagcttcctcctgtaaccactacttctcctaatgctatt
attcgttctgttcaatggatacgctcatttgttccccaggctccgattcaccaggtgatc
aacacacttgctcaaactaagtgggatgagactgcagcactttctattttatctcaaaaa
tatttgagttgtgaccttggtattccaatacaagagcataaaaggtttaagcaaagtccc
gttgctagcaatatgcctacttatggaagctctaaccgtacggttcaatcccaaaagcgc
tcgattcgggacaaatatatacaaatgccaaatgattctacgcaagcttcccttatgcct
tcttataccagaaaaactagcaatgcatcaaagaaacttactactgaagaagatgaattt
tatgactcagaagaagagcctgaagccatagttcacagggatacatcggcgttagagaga
actgtactcaattttataaacagcagtactgctaaggaactctctgatactgctagttgc
cctttgtcccactcgaaactccttttagagcatcgtcctttccagacacttgccgaagct
tgtatcatcaaacatcctgatgacgttcctagcaaacctggtagacgtggaaggcgtcgt
gaaaaaaatcctatgggccaaaaaatcgtcaatgcttgtatggaaaccatggaaggatat
tatgcaattgataatctaattgccaaatgcgagtttcttggtaatcgtatatctaaaggt
atggcctcgtggggaattaaattagaaatgtctaatggtgaactgaacatcgttgacatg
gagtcggttcctaccgaggcagcggataacagtgatttccctaaatttgttacagagcaa
cccaaaactcttgcaagtgacgtccagcttaaaagttatcaactcgttggcgttaattgg
ttacatttgctttatcaacagaaactgtcagggattttggctgatgagatgggtcttgga
aaaacttgccaagtagtcgccttttttgcacttcttctggaacaaggacaccacggacct
catttagttgtagtcccttcttcaacgcttgaaaattggcttagggaacttgcccggttt
tgccctagcctccgcgtggaaccttactacggaagtcaacaagagcgagcaaatattcgc
gaagcaatagaagaaaacgaaataaagtatgacattttggttactacttatcagttagct
acgaacaacaaagaggaccgatcttttcttaaacatcaaaactttgatgtctgcgtttac
gacgaaggtcattatttgaaaaatagaatgtcggagcgttacaaacatctcatgaacctt
aacgctaactttagactgctgctgactggtactcctttacaaaacaatctcaaagaatta
gtttccttgctcgctttcattcttcctaatatgtttgacagtgacatggacgatttggat
gtaatttttaaagctaaaccaaccgcagatgcggatatagaacaagccttactttctaag
caacgtattagccgtgccaagactatgatgactccgtttgtccttcgccgtcggaaaaac
caagttcttaatgatttgccaaaaaagactcagattattgaacattgtaagttatcagaa
aaccagttggaaatttacaatcgatatgctgctttgcaaaaaaatcaacaacttcggaga
gacgataaacgaaacaagcgtagtaagaacgatgaagaaagcgatggcaagtcattatcg
gccggtcatgttctcatgcagcttcgcaaagctgcaaatcatgccttactttttcgcaaa
ttttatgacgatgagaagttaaagcaaatggctaaggatataatgcaagaggaacaatat
aaaaatgccaatgaacaatatatatatgaagatatggaagttatgtctgactttgaattg
catcgactttgccgcagtttccctacgctgcagtcatatacgttgaaggatgatccctgg
atggattcaggtaaaattcgagtgttgaaagaattacttcctaaaatgaaagaagaagga
agcaggatccttttgtttagtcagtttactcagatgctcgatattttggaacaggtgctg
gatactttgaaaatatcatatgttcgattggatggttcaacacaagttgaagtacgtcag
gatattatagatcaatttcacaaagaggaagatgttactgtattccttctttcaacaaaa
gctggcggttttggaattaatttagcgtgtgcaaatgtggtgatattgtatgactgctct
tataatccattcgatgatttgcaggctgaagaccgtgctcatcgtgttggacaagtccgt
gaggtaacggtaattcggttaatcaccgataatacgattgaagaatatattcaaaaatta
gcgaacaccaaacttgcgcttgacatgagcttaagctctgatggtaaggatagagaagaa
attggcgaacgtcttgtgcaagacatgcttgacgaagaaaataatggcaacaatacaaaa
cctgaaattacgggaaacgagagtgatggagagttcaaggtcagcagcagtaataattcc
aaacaaacggatgcggaggagactaatacaggagttcccttagagggttctcaaccgaac
tctgtggagaaaactgacttggctgacggggacgaaaaggctaacataaaaactgagatg
aagagtgagactgtagagggtgataataaggaacttcgagaaaccatgaagggcgaaaat
gttcaaacggattctaatgctgctgtaccgtcgtcaaaatcttcaaccgaagaaccaaac
gaatctgtacttagcggccatttagatttagacaccgaggcgtcacctgtcgtaagcaca
atagaaaaaactaccaagggcgatgtttccgttacggaagagcaacagtccgctaatatc
gacggtcaattggagaaacccgaaattgaggaaagtaaaaagcctgatgtcttgaatcaa
gtttccttgtctattgaagaagaaaaaccaaaaaataaagaatcggaggttgacaataat
gctgctaaagactga

DBGET integrated database retrieval system