KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1235.07
Entry
SPCC1235.07       CDS       T00076                                 

Gene name
fta7
Definition
(RefSeq) kinetochore protein fta7
  KO
K11697  kinetochore protein Fta7
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1235.07 (fta7)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Mis6 complex
     SPCC1235.07 (fta7)
SSDB
Motif
Pfam: CENP-Q MscS_porin
Other DBs
NCBI-GeneID: 2539115
NCBI-ProteinID: NP_587733
PomBase: SPCC1235.07
UniProt: O74844
Position
III:join(190730..190845,191023..191179,191238..191402,191526..191822)
AA seq 244 aa
MEMKRRVRAVRRDQIQKRWRPLEDKQRQEIIIIFRTCSRLVLNTIKSETRKSLAEEWFMN
ILLKIEAPLRNLPVPRKRKESILFSQLLSSNMQLEQQLYSDLDHINVLQQELKVETARLE
NEQKSYEEMKQNMAINNSRLADLKSKLHPYLKKGLKISHDNFSDSNDFSFQKKLNTEDSN
TSKTSTLDMYKEKLKPFTKTMQIHANKTVQLSQTIQKATLLLQRLNNTKNIGLNKSSKLK
IKNI
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaaatgaaaaggcgcgttcgcgcggtgcgtcgagaccaaattcaaaaaagatggcgt
ccattagaggataagcagcgccaagaaataataattatttttaggacgtgttcaagattg
gttttgaatacaataaaatcagaaacaagaaaatctttggccgaggaatggttcatgaat
atacttttaaaaatcgaagctcctctgagaaatttgcctgtaccaaggaaaagaaaagag
tcaatactgttctctcaattactttcttcgaatatgcaattggaacagcaattatacagt
gatttggaccatattaacgtacttcaacaggaattgaaggttgaaactgctcgtttggag
aatgaacagaaatcttacgaagaaatgaaacaaaacatggccataaataattcacggctt
gccgatttaaaatctaaacttcacccttatttgaagaaaggcttaaagatatcccatgat
aatttttcagactccaacgatttctcgttccaaaagaaactgaatacagaagattctaat
acttctaaaacctctacattggatatgtataaagaaaaattaaagccatttacgaaaact
atgcaaatccatgcaaataaaactgttcaattaagtcaaactatacaaaaagctactctt
cttttacaacgactaaacaatacaaaaaatataggcctaaataagtcatccaaacttaag
ataaagaatatctag

DBGET integrated database retrieval system