KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1235.09
Entry
SPCC1235.09       CDS       T00076                                 

Gene name
hif2
Definition
(RefSeq) Set3 complex subunit Hif2
  KO
K04508  transducin (beta)-like 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 LisH Nbas_N Vps16_N
Other DBs
NCBI-GeneID: 2538701
NCBI-ProteinID: NP_587735
PomBase: SPCC1235.09
UniProt: O74845
Position
III:join(194552..194603,194694..195460,195499..195918,195971..196426)
AA seq 564 aa
MDTNQVNYIIWRYLKECGYSHTKFAFERETGIQNLDKQWGSTCQVGALVEILQKGLQYVE
LEKHYVDNHSSNEEASKTSIDGESLVNENPCKLPFYLTVPHICETTLTKADSTNGFCEHN
NSNDHQLKILQDKGSGSPSSPVMPFKDKIEKRDIDITMADESNVEKDPARPIAVYNSSPV
TEITEIKQVTFTGGEDIKSDFFKVIPTKHPVTCADWRPLLQENYHVYEFSIGMTNATLAS
VSICEEQNDFKAKTDYCLQSSFDNQDITGVAWNNSGSFLAYAFFSGVIEIYDSHGSQILS
FHNNKGPVLSLKWSGTDTYLAAGSADGTITLFDQLKQTQYSIDTLASSVLDIEWISFDEF
VTSDVEGSLRVYKVDGKAPVSTVSHAHDNSIVALRYNLRISLLLTASSDTTVKLWSRGDA
GAFECLHVFSFSSPVNCIDWNLREGTPILAVASNSIVSMYNAISLQQLAVFMRHTAPVSA
LSFSHNGRYLATGDTSGGVCIWSCKTAKLFKELGSDNSELIAVTNVLPEEQVNFLRWSFD
DKDLLIGKQKKEIICCCDFLHDSL
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggatacgaatcaagttaattatataatctggagatatttgaaagaatgcggttattcg
catactaaatttgcatttgaaagggaaacaggcatccaaaatttagacaaacaatgggga
agtacttgccaggttggcgctttagtcgaaattctgcagaagggtttacagtacgtggag
ctcgaaaagcactacgttgataatcactcctcaaacgaagaagctagcaaaacatctata
gatggagaaagtcttgtaaatgaaaatccttgtaaactccctttctatctcaccgtacct
catatatgcgaaacgacactgacgaaagctgactctaccaatgggttttgcgaacacaat
aattctaatgatcaccaacttaaaattttacaagataaggggtctgggtcgccttcatct
ccggtcatgccatttaaggataaaattgagaaaagggatattgacattactatggccgat
gaatcaaacgtagagaaggatccggctcgacctatagccgtgtacaacagttcacctgtc
acggaaataacagaaataaaacaggttacttttactggcggcgaagacataaagtcggat
tttttcaaagtaattcctaccaaacaccccgttacctgtgcagattggcgtccactatta
caagaaaattaccatgtttacgaattttctattggtatgacaaacgctactctggcttca
gttagcatttgtgaagagcaaaatgatttcaaggcaaaaacagattattgtctgcaatct
tctttcgataaccaagatatcactggcgttgcttggaataattctggttcttttttagcc
tacgcattcttcagcggtgtgattgaaatttacgatagtcatggttctcaaatccttagc
tttcataacaacaaaggccctgttttatctttgaaatggagcggtactgatacatatcta
gctgctggttcggcggatggaactattacactctttgatcaactgaagcaaacacaatat
tcaattgacacacttgcatcttccgttttagacattgaatggattagctttgatgaattt
gtaacttcggatgtggaaggctccttgcgagtatacaaggtcgatggcaaagctccggtt
tctacagtttctcatgcgcatgataattctattgttgctttacgatacaatctacgtatc
tctcttctattaactgcttctagtgataccactgttaagctttggtctagaggtgatgct
ggtgcttttgaatgtttacatgttttttcttttagctcaccggttaattgtattgactgg
aatttgcgggaagggacaccaattctagcggttgcttcaaacagtatcgtttctatgtat
aatgctatttcccttcagcaacttgctgtattcatgaggcatacagctcctgttagtgct
ttgagcttcagtcataacggtcgctatcttgctactggtgatacttctgggggagtatgt
atatggtcatgcaaaacagccaaactatttaaggaactgggttccgataactcagagtta
attgctgttactaatgtacttccagaggagcaagttaatttcttacggtggagttttgat
gataaagatttacttatcggtaaacaaaagaaggagattatttgttgttgtgatttttta
catgattctctgtaa

DBGET integrated database retrieval system