KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1235.13Help
Entry
SPCC1235.13       CDS       T00076                                 

Gene name
ght6
Definition
(RefSeq) hexose transporter Ght6
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    SPCC1235.13 (ght6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC1235.13 (ght6)
Transporters [BR:spo02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    SPCC1235.13 (ght6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 Pex14_N MFS_3
Motif
Other DBs
NCBI-GeneID: 2538845
NCBI-ProteinID: NP_587739
PomBase: SPCC1235.13
UniProt: O74849
Position
III:204733..206340
Genome map
AA seq 535 aa AA seqDB search
MAKILTIVMLVFVSMAGWMFGADTGSIGGITNMRDFQSRYADRYDPVTDTYSYSSARQGL
LVGMVNTGTTVGCLLSSPLGDRFGKRKCIMGWTLVYITGVIVQLTTIPSWVQMMVAKIWT
GLGIGALSVIAPGYQSESSPPHIRGAIVTTYQLFITLGIFIAACINMGTHKYTTHPEAQW
RVPIGINLLWGILMFFGMLFLPESPRYLAVKGRNEECMKILTRNAGLPADHPIMQKEYNA
IQADVEAELAGGPCSWPQIFSNEIRYRTLLGMGVMAFQQLTGNNYFFYYGTQVFRGTGLN
SPFLAALILDAVNFGCTFGAIFVLEYFGRRGPLIVGGVWQSICFFIYASVGDRALTRPNG
TSNHRAGAVMIVFSCLFIFSFAQTWAPAAYVIVGESYPIRYRSKCAAVATASNWFWNFMI
SFFTPFISNSIGFKYGYVFAACNLCAAIIIFLFAKETKGLTLEEINQLYLSNIKPWNTGA
YQRDREDIKQSDSEKERGPTSKLHEYVEHAPNSYASTHSTESENYPQQVTNPVGL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcttaaccattgtcatgttggtcttcgtgtccatggccggatggatgttc
ggtgctgacacgggttccattggtggtatcactaatatgcgggactttcaatctcgatac
gcagacaggtatgatcctgtcacagatacgtattcgtattcttctgctcgccaaggtctt
ttggttggtatggttaacactggaactactgttggatgtttactttcttcacctcttgga
gatcgattcggtaaacgtaagtgtatcatgggatggacattggtttacattaccggtgtt
atcgttcaactcaccacaattccatcttgggttcaaatgatggtagctaaaatttggact
ggtcttggcattggtgctttgtcagtcattgctcctggttaccaatccgaatcttctccc
ccccatattcgtggtgccattgtaactacttatcaattgttcattactcttggtattttt
attgccgcctgtatcaacatgggtactcacaaatacaccactcatcctgaagctcaatgg
cgtgttcccatcggtattaacttactttggggtattctcatgttctttggaatgcttttc
ctccctgaatccccacgttaccttgcagttaaaggaagaaatgaagaatgtatgaaaatt
cttactcgtaatgctggcctcccagccgatcatcccatcatgcaaaaagaatacaatgcc
attcaagctgacgttgaggcagaattggctggtggtccttgctcctggcctcagatcttt
agcaacgaaattcgttacagaacacttttgggaatgggtgtcatggcattccaacaattg
accggtaacaattacttcttctactatggtactcaggtattccgcggtactggcttgaac
tcccccttcctcgcagctttgattcttgatgctgtcaactttggatgtacgtttggtgct
atctttgttcttgaatactttggtcgtcgtggtcccctcatcgttggtggtgtttggcaa
tctatttgtttctttatttatgcttctgtaggtgatcgtgcacttacccgccccaatggt
acttcgaatcatcgtgctggtgccgttatgattgtgttctcatgtcttttcattttcagt
tttgctcaaacttgggctcctgccgcatacgttatcgttggtgaatcgtatcccattcgt
tatcgttccaagtgtgctgccgtcgctactgctagcaactggttctggaactttatgatt
tccttcttcactccctttattagcaactcaattggtttcaagtatggttatgtgtttgca
gcttgcaacttgtgtgccgctattattattttcctattcgccaaggaaaccaaaggtctt
accttggaagagattaaccaactttatttgtcgaatattaagccctggaacactggtgct
taccagcgtgatcgggaagatattaagcaaagcgactcagaaaaggagcgtggacctact
tctaagttacatgaatacgttgagcatgctcccaactcgtatgcttcaacacactctaca
gagagtgagaattatcctcaacaagtcaccaatccggttggcttatga

DBGET integrated database retrieval system