KEGG   Schizosaccharomyces pombe (fission yeast): SPCC126.01c
Entry
SPCC126.01c       CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: WD40 Nup160
Other DBs
NCBI-GeneID: 2538691
NCBI-ProteinID: NP_588444
PomBase: SPCC126.01c
UniProt: O94394
Position
III:complement(2115316..2116425)
AA seq 369 aa
MQTNNPSYFFRSESALQDEKRKEEKSHNPNGNPRNLKAKILNIELDRTTPKKKQFPRLFV
CEASHICKLYDLEINKTCKTYKGHSGPVTCCQIESLRKDGKVRHIYTGSWDHTIKKWNVS
TGECVETLIGHTDYVKCLLLLEEEGLLLSGSTDASLIVWDVSSQPSRLLYKLTGHSRGIE
CITRQPNTDIFWTCGSESSIRCWHITKVGGSQLEEEGFWGHQSNVYCLLFDPQDSEALWT
ASADKTVREWSLYQGIHEETRMEHPDVCTDVLTLADGNIATACRDEEIRVWDTTTGNVKD
IYSGHYESVTKILQWKSYLISSSLDQTIRVWDLEYSADNNEADDHPSLGPPSTKLTAEEL
AELEELMND
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgcaaaccaacaatccttcatacttttttcgctccgagagtgcgttgcaagatgaaaaa
agaaaagaagagaaatcacataatccaaatgggaatcctagaaatttaaaggcaaagatt
ttgaatattgagctagatcggactacaccaaaaaagaagcaattccctagactatttgtg
tgtgaagcttctcatatatgcaaactttatgacttggaaataaataaaacttgcaaaaca
tataagggacactcaggtcctgtcacatgctgtcaaattgaaagtcttcgaaaagacggc
aaagtacggcatatttacactggttcttgggatcataccataaaaaaatggaatgtctca
acaggtgaatgcgttgaaacgctaattggtcacactgactacgttaaatgtctactgtta
ctggaagaagagggattactgttatctgggtcaacagatgcttccttaatagtatgggat
gtttcttctcaaccaagtcgcctactgtacaagcttacaggacatagtcgtggaatcgag
tgtattaccagacagcccaacacagacattttttggacgtgtggcagcgaaagcagtatt
cggtgttggcatattactaaggttggcggcagtcagttagaggaagaaggtttttgggga
caccagtccaacgtttattgtttactgtttgatccacaagattctgaggcattatggaca
gcttcggcagacaaaactgttagagaatggtccttgtatcaaggtatacacgaagaaact
agaatggaacacccagacgtatgcactgatgttcttactctagctgatggaaatatagca
acagcatgcagagatgaagaaattcgtgtatgggatacaacaactggtaatgtaaaagat
atatattctgggcactatgaatcagtgacaaaaattttacagtggaaatcttatttgatt
agttcttccctggatcaaacgataagagtgtgggatttagaatattctgcagacaacaac
gaagcagacgatcacccatcattgggacccccttctaccaagttaactgcagaagagctt
gcagagctagaggaattgatgaacgattga

DBGET integrated database retrieval system