KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1322.05c
Entry
SPCC1322.05c      CDS       T00076                                 

Definition
(RefSeq) putative leukotriene A-4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00590  Arachidonic acid metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SPCC1322.05c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPCC1322.05c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     SPCC1322.05c
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M1
   SPCC1322.05c
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Herpes_UL95
Other DBs
NCBI-GeneID: 2538917
NCBI-ProteinID: NP_588133
PomBase: SPCC1322.05c
UniProt: O94544
Position
III:complement(1294076..1295914)
AA seq 612 aa
MKLRLDPSTQSNYHDVSISKLDWHARIDFDQELLHGKVSFVIQSARVSQALSHIILDTSY
LEIKNVTINDIPTPFRVDKRRGFLGSALHIVPADEIPSSKSCILTILYSTTKDCTALQFL
KPEQTIGGKFPYVFSECQAIHARSFIPCQDTPSVKVPCTFKIRSKLPVIASGIPCGTANF
CNGSLEYLFEQKNPIPSYLFCILSGDLASTNIGPRSSVYTEPGNLLACKYEFEHDMENFM
EAAEQLTLPYCWTRYDFVILPPSFPYGGMENPNATFATPTLIAGDRSNVNVIAHELAHSW
SGNLVTNESWQCFWLNEGMTVFLERKILGRLYGEPTRQFEAIIGWGELEESVKLLGEDSE
YTKLIQNLEGRDPDDAFSTVPYEKGSNFLYEIERVIGGPSVFEPFLPFYFRKFAKSTVNE
VKFKHALYEYFSPLGLASKLDSIDWDTWYHAPGMPPVKPHFDTTLADPCYKLAESWTNSA
KNSDDPSKFSSKDIENWSAGQKSLFLDVVYEAVSFPHNYIKRMGDVYSFAESKNAELSFR
FFKLALKSKYKPLYNTIAERVGSVGRMKFVRPIFRLLNEADRAFAIETFEKYKHFYHKIC
ASQVEKDLGLSE
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaaacttcgtttggacccttccactcaatctaattatcatgatgtctcaatcagtaag
ctcgattggcacgctcgaattgactttgaccaagagctgctccatggtaaagtatccttt
gtgattcaatctgctagggtgtcccaagccctgtcccatattatccttgacacttcttac
ctcgaaatcaagaatgtaacgattaatgacatccctactcctttccgtgttgataagcgg
cgcggatttttgggttcagctttgcatatcgttcccgctgatgaaatcccttcctcaaaa
tcctgtatacttacaatcttatattccactactaaggattgtacagcacttcagtttttg
aagcctgaacaaacgataggtggtaaatttccttatgttttttcggaatgtcaagccatt
catgcacgttcattcattccctgtcaagatactccttctgttaaagttccgtgtactttt
aagatccggtccaaacttcccgtaatcgcatcgggtatcccatgtggaacagctaatttc
tgcaatggctctttggaatacctgtttgagcaaaaaaatccaatccctagttatttattt
tgcattctcagtggtgatttggcctccacaaatataggtccacgttcttctgtatacaca
gagcctggcaacttgttagcttgcaaatacgaatttgaacatgacatggaaaactttatg
gaagccgccgagcaactaacacttccttattgctggacacggtatgattttgtcatcctt
ccgccttccttcccatacggaggtatggagaaccctaatgctacgtttgctacgccgaca
cttattgccggagatcgctccaatgttaacgttattgctcatgaattagcccattcttgg
agcggtaatttagttactaatgagtcatggcaatgcttttggttgaatgaaggtatgact
gttttcttggaacgcaaaattttaggccgtctttatggtgagccgactcgccaatttgaa
gccattattggctggggtgaattagaagaatcggttaaattgttgggtgaagatagtgag
tatacgaagttgattcaaaacctcgaaggaagggatcccgatgatgccttttccactgtt
ccttacgaaaagggctccaatttcctctatgaaatagagagggttattggtggtccttct
gtttttgaaccattccttcccttttactttaggaaatttgcaaagtctaccgtaaacgaa
gtcaaattcaagcatgcactgtatgaatacttctcacctcttgggcttgcatctaagttg
gactcgattgattgggatacttggtaccatgctcctggtatgcctccggttaaaccacat
tttgatacaacgcttgcagatccttgctacaagcttgcagaaagctggactaattctgct
aaaaattctgatgatccctccaagtttagcagcaaagatattgaaaattggtcagcgggc
cagaaatctttgtttttggatgttgtttatgaagctgtctcttttcctcacaattatatt
aaaagaatgggtgatgtttactcgtttgccgaatcgaaaaatgcagagttatctttccgg
ttttttaaactcgcattgaagagtaaatataagccattatacaacactattgcagaacgt
gttggcagcgttggccgtatgaagtttgttcgcccaattttcagactgttgaatgaggca
gatcgtgcttttgcaattgaaacgtttgaaaagtataagcatttctatcataaaatttgt
gcttctcaagttgaaaaggacttaggcttatctgaatag

DBGET integrated database retrieval system