KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1322.08Help
Entry
SPCC1322.08       CDS       T00076                                 

Gene name
srk1
Definition
(RefSeq) MAPK-activated protein kinase Srk1
  KO
K23785  serine/threonine-protein kinase RCK2 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPCC1322.08 (srk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPCC1322.08 (srk1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CAMK group
  Other
   SPCC1322.08 (srk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal DUF4107 RIO1
Motif
Other DBs
NCBI-GeneID: 2539027
NCBI-ProteinID: NP_588136
PomBase: SPCC1322.08
UniProt: O94547
Position
III:join(1302900..1302911,1303135..1304865)
Genome map
AA seq 580 aa AA seqDB search
MRFKSIQQNIEDEGKVNVREVNPDSYAERDHGYTAGIFSDAEENFGITQQVADSTQNPTS
KPKSRHAHFHETVHENPSEYSRSKCKQPTNEKEYDKAIEALVAKAIVEEHSGQQFPVYKG
LEQYTLLQKMGDGAFSNVYKAIHNRTGEKVAIKVVQRAQPNTDPRDPRKRQGVESHNILK
EVQIMRRVKHPNIIQLLEFIQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQV
AHAIRYLHEDCGVVHRDIKPENLLFDSIDFVPSRVRKYRAGDDPDKVDEGEFIPGVGAGT
IGRIRLADFGLSKVVWDSHTQTPCGTMGYTAPEIVRDERYSKGVDMWALGCVLYTILCGF
PPFYDESISLLTKKVSRGEYSFLSPWWDDISKSAKDLISHLLTVDPESRYDIHQFLAHPW
ISGSREPTFPATDAPNTAQRENPFTYDFLEPEDVAAAGSAARTPGVNSLREVFNISYAAH
RMEQEKIRKRGQRGNQGIMNFMGDMDDLMEENDDYDDGTKSVEHSMKRVNLSGENDPSLA
SRQPAQSQQQSSQRSRNKFKGFQLNLSKATLYNRRHRQKV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttaaaagtattcagcaaaatatcgaggacgagggcaaggtgaacgttcgcgaa
gtgaatcccgattcctatgctgaacgggaccatggctatactgctggcatattttcggat
gctgaagaaaattttggcataactcagcaagtagcggactccactcaaaatcccacctcg
aaacccaagtcccggcatgcacatttccacgagacggtgcacgagaatccttccgaatat
tcgcgctccaaatgtaaacaacctaccaacgaaaaagaatatgataaagccatcgaggct
ttagttgcaaaggccattgttgaggaacattccggccaacaatttcctgtatataaaggc
cttgaacaatacactctattacaaaagatgggcgatggtgcttttagtaatgtatacaaa
gctattcacaacagaacgggtgaaaaagtcgccattaaagttgtccagcgcgctcaacca
aacaccgatcctcgcgatcccagaaaaagacaaggcgttgaatcgcacaacattttaaaa
gaggttcaaatcatgcgtcgcgttaaacatcctaacatcattcaactcttggaattcatc
caaaccccggaatactattacctggttttagagctggctgacggtggtgaattatttcat
caaatcgttcgcctcacctatttttccgaagatttgtctcgtcatgtcataactcaagtt
gcacatgccattcgatatctgcatgaagactgcggtgtcgttcatcgtgatatcaaacct
gaaaacctgctttttgattctatcgactttgtgccctctcgggttcgtaaataccgtgcc
ggagacgatcccgataaggtagacgagggcgagtttattcccggtgtcggcgctggcacc
atcggtcgaatccgtctcgcagatttcggtctaagcaaagtggtttgggactctcacact
caaactccgtgtggcactatgggctatacagcccctgagattgtccgtgatgaaaggtat
tctaagggagttgatatgtgggctttgggatgcgtattgtacactattctttgtggattc
cccccgttttatgatgaaagcatttctttgttgacgaaaaaagtctcacgaggcgagtat
tcattcctttctccttggtgggatgatatttcaaagagtgcaaaggatttaatcagtcat
ttattaactgtcgacccggaatctcgttacgacattcatcaatttttagcccatccatgg
atttcgggctctcgggaacctacctttcctgccaccgatgctcctaacactgctcaacgc
gaaaacccatttacctatgactttcttgagcccgaagacgttgctgctgccggttcagcc
gctcgtactcctggtgttaactcgttgagagaagtatttaatatttcgtatgcagcccac
cgaatggaacaagagaagattaggaaacgtggtcaacgtggtaaccaaggaatcatgaat
tttatgggtgacatggatgatttgatggaggagaatgatgattacgatgatggtaccaag
agcgttgaacattcgatgaaacgagtcaacctgtcaggtgaaaacgatcctagccttgct
tcccgccaacctgctcaatcgcaacaacaatcatctcaaaggtcgcggaataagttcaaa
ggtttccaactcaacttgtcaaaggcaactttgtataatcgtcgacatcgacaaaaagtg
taa

DBGET integrated database retrieval system