KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1393.04
Entry
SPCC1393.04       CDS       T00076                                 

Gene name
fta4
Definition
(RefSeq) Sim4 and Mal2-associated protein 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FTA4 Prefoldin_2 Spc42p PDU_like PCRF
Other DBs
NCBI-GeneID: 2538719
NCBI-ProteinID: NP_587962
PomBase: SPCC1393.04
UniProt: O94716
Position
III:join(799843..799984,800059..800618)
AA seq 233 aa
MDIYEHKKSFMERQIRLLNRPMRPPKDWKLPLKSGQLSESVVETVFQRLQLRIQKHAKLN
YSHQATQHVAAQIRKLYEQNSAIEDITFLNPLFYGEIDLSNLDSVKSLPHPWPFQKESRP
VEKDEEQEKFNRLTGELLGLLTTLSELEQERSELEQIEKMLEPFEDGPSSIHTNMWKKNP
ELISTLNSTNTMVAKINSLLRGVSFPSLNNDNQEASLEDEIRSQLFEKTISDD
NT seq 702 nt   +upstreamnt  +downstreamnt
atggatatttacgaacataaaaaatcattcatggaacgacagatacggctgttgaaccga
cctatgcgccctccaaaggattggaaacttcctttaaaatccggtcagctttcagaatca
gtcgttgaaactgtattccaacgattgcaacttcgtatccaaaagcatgcaaagctaaat
tattcacatcaagcaactcagcatgttgccgctcaaatacgaaagttatatgaacaaaat
agcgctattgaggacattacctttttaaatccattattttatggagaaattgatttaagc
aatttagacagtgtaaaatcacttccccatccatggccttttcaaaaagaatcccgacct
gtcgaaaaggatgaggagcaagagaagttcaatcgtcttacgggagagttacttggtcta
ttaacaacgttgtcagaattagaacaggagcgctctgaacttgagcaaatcgaaaaaatg
ttggaaccttttgaagatgggccttcttcaatacatacgaatatgtggaagaaaaaccct
gaattgatatcaaccctcaacagtacgaacaccatggtagctaaaattaattctcttctc
agaggggtttcatttccttctttaaacaatgacaatcaggaagcgtcattggaggacgaa
atcagaagccaattattcgaaaaaactatttctgatgattaa

DBGET integrated database retrieval system