KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1393.10Help
Entry
SPCC1393.10       CDS       T00076                                 

Gene name
ctr4
Definition
(RefSeq) Cu transporter complex subunit Ctr4
  KO
K14686  solute carrier family 31 (copper transporter), member 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC1393.10 (ctr4)
Transporters [BR:spo02000]
 Solute Carrier Family (SLC)
  SLC31: Copper transporter
   SPCC1393.10 (ctr4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ctr SK_channel
Motif
Other DBs
NCBI-GeneID: 2538731
NCBI-ProteinID: NP_587968
PomBase: SPCC1393.10
UniProt: O94722
Position
III:818459..819328
Genome map
AA seq 289 aa AA seqDB search
MSFFSAAKQSLGNSLIKLGTSMAQNSQGPVDDSSLSQLENLLPPLQILTARAAMAAMNMS
NDTSMSGMNMTNSTTPMSGMNMTNSTTSMSGMNMSNSTTSMSGMNMTNTTTTAKASSCKL
SMYWNWYTIDACFITKHWHITSKHMFVGSIFGIIFMMMALELVRRGQREFDRWCVRRFSP
ASNSCCHSGAPVHSGPSMALRIFLHFLRSCFYLVQYIVAYIAMLLAMYYNGYVILFLFCG
TFFGYFLFGADTISTKASSSVQTKTIVQVADEKHEHDSSQYSDTTPTTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttctccgctgcaaagcaaagtctgggtaattccctcattaagttaggaaca
tctatggctcaaaattcccaaggccctgtagatgactctagcttgtctcaattggagaat
ttgctcccacctttgcaaattttgactgctagagccgctatggctgctatgaacatgtcg
aatgatacatccatgtctggaatgaacatgaccaacagtacgacacccatgtctggaatg
aacatgaccaatagtacaacatccatgtctggaatgaacatgtccaacagcacaacatcc
atgtctggcatgaatatgactaataccactacaaccgcaaaggcttcttcttgtaaatta
tccatgtattggaactggtatactatcgatgcttgctttattaccaaacattggcatatc
accagtaagcatatgtttgtcggtagtattttcggaattatcttcatgatgatggcattg
gaattggtccgtcgcggacaaagagagttcgatcgttggtgtgtccgtagattttctccc
gctagcaattcctgctgtcattcgggtgcccctgttcattctggtccaagcatggccctt
cgaatctttcttcattttcttcggtcctgcttttatctagtccagtatattgtcgcgtat
atcgcaatgttactcgcaatgtattataatggctatgtaattttatttctcttttgtggc
accttctttggctatttcctgtttggtgcggataccatctctactaaggcctcttcatct
gttcaaacgaaaacgatcgttcaagtcgccgacgaaaaacacgaacatgattccagtcaa
tattcagacacaacacctacaaccgaatag

DBGET integrated database retrieval system