KEGG   Schizosaccharomyces pombe (fission yeast): SPCC13B11.01
Entry
SPCC13B11.01      CDS       T00076                                 
Symbol
adh1
Name
(RefSeq) alcohol dehydrogenase Adh1
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00071  Fatty acid degradation
spo00350  Tyrosine metabolism
spo00620  Pyruvate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC13B11.01 (adh1)
   00620 Pyruvate metabolism
    SPCC13B11.01 (adh1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPCC13B11.01 (adh1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SPCC13B11.01 (adh1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPCC13B11.01 (adh1)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_2 adh_short AlaDh_PNT_C ADH_zinc_N_2 Fer4_6
Other DBs
NCBI-GeneID: 2538902
NCBI-ProteinID: NP_588244
PomBase: SPCC13B11.01
Ensembl: SPCC13B11.01
UniProt: P00332
Position
III:1589427..1592889
AA seq 350 aa
MTIPDKQLAAVFHTHGGPENVKFEEVPVAEPGQDEVLVNIKYTGVCHTDLHALQGDWPLP
AKMPLIGGHEGAGVVVKVGAGVTRLKIGDRVGVKWMNSSCGNCEYCMKAEETICPHIQLS
GYTVDGTFQHYCIANATHATIIPESVPLEVAAPIMCAGITCYRALKESKVGPGEWICIPG
AGGGLGHLAVQYAKAMAMRVVAIDTGDDKAELVKSFGAEVFLDFKKEADMIEAVKAATNG
GAHGTLVLSTSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKMLKICGSHVGN
RIDSIEALEYVSRGLVKPYYKVQPFSTLPDVYRLMHENKIAGRIVLDLSK
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgactattcctgacaagcagttggctgccgttttccacacccacggtggtcccgagaac
gtcaagttcgaggaagtccccgtcgccgagcccggtcaagacgaggtcttggttaacatc
aagtacaccggtgtctgccacaccgatttacacgctcttcaaggtgactggcctcttccc
gccaagatgcctttgatcggtggtcacgaaggtgctggtgtcgtcgtcaaggtcggtgcc
ggtgtcactcgtcttaagattggtgaccgtgttggtgtcaagtggatgaactcttcttgc
ggtaactgcgagtactgtatgaaggctgaggagaccatctgccctcacattcaactttcc
ggttacaccgttgacggtactttccaacactactgcattgccaatgccacccatgctacc
atcatccccgagtccgttcccctcgaggttgctgctcccatcatgtgcgctggtatcact
tgctatcgtgccttgaaggaatccaaggtcggccctggtgagtggatctgcattcccggt
gccggtggtggtcttggccatcttgccgtccaatacgccaaggctatggctatgcgtgtt
gttgccattgatactggtgatgacaaggctgagctcgtcaagtcctttggtgctgaggtc
ttccttgacttcaagaaggaagccgacatgattgaggctgtcaaggctgccaccaacggt
ggtgcccacggtaccttggtcttatccacctcccccaagtcttacgagcaagctgctggc
tttgcccgtcccggttccaccatggtcactgtttccatgcctgccggtgccaagctcggt
gctgatatcttctggttgaccgttaagatgcttaagatctgcggttctcacgtcggtaac
cgtattgactctatcgaggctcttgaatacgtttcccgtggtctcgtcaagccttactac
aaggtccaacccttctctactcttcccgacgtctaccgtctcatgcatgagaacaagatt
gccggccgtatcgtcttggacctttccaagtaa

DBGET integrated database retrieval system