KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1442.02
Entry
SPCC1442.02       CDS       T00076                                 

Name
(RefSeq) putative central kinetochore-associated family protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Kinetochor_Ybp2
Other DBs
NCBI-GeneID: 2538698
NCBI-ProteinID: NP_588317
PomBase: SPCC1442.02
UniProt: Q76PC4
Position
III:join(1768993..1769166,1769224..1770738)
AA seq 562 aa
MDWKEAIPGAAKVAIETKDYITYSTLLELILEEARIKDIDEQRELIKCLHEELKQEKNDH
ITREISWDIIGMVLPYVGKVQNEADEFVDFLAKNGNPREVFLKCCELLINGGFESPQQFI
SLNSAILSALHRISTKRPVLFVNNFLISLFSGLANILQIDSDELYCVWKISISSIQDAMH
RFPVSECYLACLKACSILAQLFLSKETLMLSFRSLLQTKDQYAEFREELSGATTNCDKLD
TLSKSIINIFDYLLSHLPESWSIITEHMAQELTKATYVSQSSSISSEDEEIAKNADVPAE
VDNNSTKADDKRDEIEFDTKGCLALLTIKSFYQSGNFFLDFLKEKFPSTILETLQQLVSW
EIQLDSVGFKDIAVYQGYLLDLPHFQVPDSELEHLSSLLHGYHFMASSTELPWLRVTCNA
IVTKCLDSQLPSVRLSYILDTLEECPLLNIKTAILNYYQKQCSLVKDSNEEGLKNFVSPN
TLLDVFKVFDAMEDVELDSQSLSYIHQTLVFLYSLEIQNLLSQNQFPTVYFTKISDQINN
YEGELPTDGLKYYIELLNSRNK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggactggaaagaagcgattccaggtgccgccaaggtagccattgaaaccaaagattat
attacctactcaacgctactcgaattgatattggaagaagcgcgaataaaggatattgat
gagcagcgagagttgattaagtgtctacatgaagaattgaagcaagaaaagaatgaccat
ataacacgcgaaatttcctgggacattataggaatggtgcttccatatgttgggaaagta
caaaatgaggccgatgagtttgtggacttcttagccaaaaacggaaatccaagagaggtg
ttccttaaatgttgtgaacttttgataaatggaggctttgaaagtccccaacaattcata
tctctgaacagtgccattttatcagccttacaccgtatatctacaaagcgaccagttcta
tttgtaaataattttttaatttcattgttttcggggttagcaaatattttgcaaattgat
agcgatgaactgtattgtgtttggaaaatctcaatatcatctatacaagatgcaatgcat
cgctttccagtgtcagagtgttatttggcatgtttaaaggcttgcagtattttagctcaa
ctctttttaagtaaagaaacattgatgctttctttccgttcgctgcttcaaacaaaagat
cagtatgcagagtttcgtgaagaactaagtggcgctacgactaattgtgacaagttggat
accctttcaaaatccataataaacatcttcgattatcttttgtcccatcttccagagagc
tggagtatcattactgagcacatggctcaggagctgacaaaagctacatatgtaagtcag
tcatcctctatttcctcagaagacgaagaaatagccaaaaatgctgatgttcctgctgaa
gttgataacaattctactaaggctgatgataagcgggatgaaattgaatttgacacgaaa
ggatgtcttgctttattaacaattaaatcgttctatcaaagcggaaacttctttctggat
tttttgaaagaaaaatttccctctactatccttgaaactttgcagcaattggtctcttgg
gagattcaattggatagtgttggtttcaaagatattgctgtgtatcaaggatatttgttg
gatttacctcatttccaggttcccgactccgaactcgagcatctctccagtttgctccat
ggatatcattttatggcttcttcgacagaacttccttggctgcgtgttacatgcaatgct
atagtcacaaaatgtctggattctcagttaccaagtgtccgtctttcctacatacttgat
actttggaagaatgcccactgttaaatataaaaactgctatcctaaattattatcaaaaa
cagtgttctcttgtaaaagatagtaatgaggaaggtttaaaaaactttgtatctcccaat
acccttctggatgttttcaaagtgtttgacgctatggaagatgttgaacttgattctcaa
tccctatcgtacattcaccaaacactggtgtttctctattcactcgagattcaaaatttg
ttaagtcaaaaccaatttcctactgtatatttcactaagatttccgaccaaataaataat
tatgagggagagcttcctacagacggactgaagtattatattgagcttctaaattctcgc
aacaaatga

DBGET integrated database retrieval system