KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1442.09
Entry
SPCC1442.09       CDS       T00076                                 

Gene name
trp3
Definition
(RefSeq) putative anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPCC1442.09 (trp3)
Enzymes [BR:spo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SPCC1442.09 (trp3)
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Other DBs
NCBI-GeneID: 2538842
NCBI-ProteinID: NP_588323
PomBase: SPCC1442.09
UniProt: O94582
Position
III:join(1783786..1783791,1783975..1785438)
AA seq 489 aa
MKIYPDLKQVQELAEKHKANKIPIYGVIPADMLTPSVAYLKLNQGKKYSFILESVTQGES
VSRYSFIGSPYRILMANGKTDPLARLERELKEVKTAPVEGLPSFSGGAVGYVSYDCIKYF
EPTTEMPLEDTLGLPEAMFFMTDDLVAFDHAYQTVKIISHVCIQQGRPIEEAYEAAVFKI
NMLKKKLESPEIPLPEQKKVHLGYEAKSNVGEDGYKAFVSNLKEHIFNGDIFQAVPSQRI
ARRTDLHPFNLYRHLRTVNPSPYMFYIHCDDFDIIGASPELLVKSEHGRIINHPIAGTVP
RGKTKEEDEAYAKDLLASVKDRAEHVMLVDLARNDVSRVCDLDTTSVDKLMTIEKFSHVQ
HLVSQVSGVLRPDKTRFDAFRSIFPAGTVSGSPKVRAIQLVYGLEKEKRGIYAGAVGRWG
YEDDNMDTCIAIRTMVYKDGTVYLQAGGGIVFDSDEQDEYVETLNKLRSNVTAIEETEKL
YAEEENSSA
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaagatttatcctgacttgaaacaagttcaagagcttgctgaaaagcacaaggctaac
aagattcccatttatggagtaatccctgccgatatgctgactccttcagtagcctacttg
aagcttaatcaaggaaagaagtattcgtttattttagaaagtgtcactcaaggagagagt
gtctcaagatacagttttattggcagcccttatagaatattaatggccaatggaaaaaca
gatcctttggcacgtttagaacgtgagttgaaagaagttaaaacagcccctgttgagggt
ctgccatctttcagtggaggtgctgtgggctatgtttcttatgattgcatcaaatatttt
gaacccactactgaaatgcctttagaagataccttgggtcttccggaggctatgtttttc
atgaccgacgatttagtcgctttcgatcatgcttatcagactgtcaagataatttctcat
gtttgcattcagcaaggccgacccattgaagaggcttacgaagctgccgttttcaaaatc
aatatgcttaaaaagaaacttgaaagtcctgaaattcctttgcctgagcaaaagaaggtc
catttaggatacgaagctaagtcaaatgtaggcgaagacgggtataaagcatttgtttcc
aacctcaaggaacatatctttaatggcgatattttccaagctgtcccaagccaacggatt
gctaggcgtacagatttacatccttttaatttgtaccgccatttaagaacagttaacccg
tccccttatatgttctacatccactgtgatgatttcgacataatcggtgcttcccctgaa
ttactggttaaatcagagcatgggcgtattatcaatcatcccattgccggaactgttcca
agaggaaaaactaaagaagaggatgaggcatatgccaaggatttacttgctagtgtcaag
gatagagctgaacatgtaatgctggtggacttggcaagaaacgatgtcagtcgtgtctgt
gatctcgacacaacaagtgttgacaagttgatgactattgaaaagttttctcatgttcag
catcttgtttctcaagtttctggtgttctgagacctgataaaactcgttttgatgcattc
cgtagtatatttccggctggaacggtcagtgggtctcccaaagtccgtgcaattcagctc
gtttatggattagagaaagaaaagcgtggtatatacgcgggagccgtaggtcgttggggc
tatgaagatgacaacatggatacttgtatagcaatccgtacaatggtttataaagacgga
actgtttatttgcaagccggtggtggtattgtgtttgattcagatgaacaagatgagtac
gtggaaactttaaacaaactacgttcaaatgttactgcaattgaggaaaccgaaaaatta
tacgctgaagaagaaaactcttcagcataa

DBGET integrated database retrieval system