KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1494.02c
Entry
SPCC1494.02c      CDS       T00076                                 

Symbol
taf13
Name
(RefSeq) putative transcription factor TFIID complex subunit Taf13
  KO
K03127  transcription initiation factor TFIID subunit 13
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPCC1494.02c (taf13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPCC1494.02c (taf13)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     SPCC1494.02c (taf13)
SSDB
Motif
Pfam: TFIID-18kDa Bromo_TP
Other DBs
NCBI-GeneID: 2538695
NCBI-ProteinID: NP_588527
PomBase: SPCC1494.02c
UniProt: O60076
Position
III:complement(join(2318335..2318508,2318579..2318676,2318903..2318966))
AA seq 111 aa
MSMENRRGRPPTRRQHLFTKDLKSLMYAFGDDVNPAPDSINVLEEIVVDYINEMCLEAAR
IAGNRNKVKVDDFKFALRDDPKKLGRVEELLVLQKMIADTRNVMKYNKDHF
NT seq 336 nt   +upstreamnt  +downstreamnt
atgtctatggaaaatagaagaggaaggccccctactcggaggcagcatctctttacgaag
gatttgaaatctctaatgtacgcatttggagatgatgtgaatcctgctccagatagcata
aatgtattggaagaaattgttgttgactatatcaatgaaatgtgcctggaagctgctagg
atagctggaaatagaaataaggtcaaagtagatgactttaaatttgctttgcgtgatgat
cctaagaaacttggtcgtgttgaggaattgttggtattacaaaagatgattgccgatact
aggaatgttatgaaatacaacaaagatcatttttaa

DBGET integrated database retrieval system