KEGG   Schizosaccharomyces pombe (fission yeast): SPCC162.02c
Entry
SPCC162.02c       CDS       T00076                                 

Definition
(RefSeq) putative AMP-binding dehydrogenase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: NAD_binding_4 AMP-binding Epimerase GDP_Man_Dehyd PP-binding Polysacc_synt_2 NmrA AMP-binding_C
Other DBs
NCBI-GeneID: 2538929
NCBI-ProteinID: NP_588242
PomBase: SPCC162.02c
UniProt: O74419
Position
III:1584480..1587425
AA seq 981 aa
MLCDSSESVSFSSISKEEDTPIARLLKNAKETPDHRFISVYNERGIVAKYTYTELLRRVN
TIAKFCDDLGLGKTVGIHMGHELDFLCSIFALWATGRTCVIFNQIWSQQVVRVLVKRLNI
SDLLYHEYKPKFEVDTLNATSLASLPLDIDAPCIRAGLEPEVALINHSSGSTGVPKSMPF
LMKKYALGYDYGTPEFMNHLSTPMVMATSFALTTLSWINALYCNGNLLYPSSSISATCTS
EAERLAWNVYYALRAGCERLIILPNLLVLTLQIMPDKEECFPACKLVAAGGEMVPANMYH
TCKRVLPNATIYPQYGTTESGLVSFLAYNGKDTLHNKELVYFPGKTVKKLMLVTEDNEAV
PEKIGCEGFVCVVTDVQSEPYVGDDAETIQSRNSTFINYDGQPAVRFADLAVWNSYKGKL
GITIKGRLGRRVKRNGVFFDLKYFDQVVVGLKEVKDAFSFFIFNRFVLVYVPAYNGVDPV
TLKQKLNKELRDHHLFSSCFPLADIPRNAAGKVDLKSIETYASKCLSVEDQRLPVLLNPV
AIEISKIASKILQNPSLEGKDAPLYSCGLDSIHSVRFFHAIQSHFHLEGPIRYNMNSNCT
PNSIASIIQKKSYNVSSITYELLNEDACALSRTIPKLSILPTNGQYFLLTGATGYFGRRF
LEYLVKLNISVVCLVRESSDEAAKERLISLVPSLRISSENIIVWAAHVEEIRFGLDDAKW
EFLVENVSRIYHMAAEVHWMKSYQELRPANVLGTKTVLELSVMGPKALYFISGGGQQEVE
LDDDTQSAKASGYALSKYVAELLCRKISDLGHPLIYVIRPGFIIANDGEILSRDFFWRFV
ATALRMGIWPQSDESQSLVFHISTTDALCMTLTQILEKEADAYAPLLAYDKFDGDEFACI
CESMKNVKLDFVTLEDWLKALEKDVDEKGEDHPLFALQHATKFALKSSMTPSNGLRNIYP
LSETFLTKEAIANGLENLYIE
NT seq 2946 nt   +upstreamnt  +downstreamnt
atgctgtgcgattcgtcagaatcagtttcgttttcatccatatctaaagaagaagataca
ccaatcgctcgccttttgaaaaacgcaaaagaaacaccagatcatcggtttatctccgtg
tacaatgaacgtggaattgttgctaaatatacatatacagaattacttcgtcgtgttaac
acaattgctaaattttgtgatgatttaggcttgggaaagacagttggaatacatatggga
cacgagttggattttctgtgttctatatttgctttatgggctactggacgaacctgcgtt
atttttaaccaaatttggtcccagcaagttgttcgtgtacttgttaaacgtttgaatatt
tctgatttgctttatcatgaatataagcccaagtttgaggtggacaccttaaatgctaca
tccttggcttcgctgccgctggatatcgatgctccttgtattcgagctggattagagccg
gaagtcgctcttattaaccattctagtgggtccacaggagtccctaaatccatgccattt
ctcatgaagaaatatgctttgggttatgactatggaactcctgaatttatgaatcatctc
tccactccaatggtaatggctaccagctttgctttaacaaccttgagttggattaatgcc
ttgtattgtaatgggaacttactgtacccatcctcttcgatatcggctacttgcacttca
gaggctgaacggcttgcttggaatgtttactatgctcttcgtgctggatgcgaacgttta
attattttacccaatctccttgttctaactctccaaataatgcctgacaaggaagaatgc
tttcctgcttgtaaactagtagcagcaggcggtgaaatggtccctgcaaacatgtatcat
acatgcaaacgagtattaccaaatgcgaccatttatccacagtatggtactactgagtcg
ggattggtttcatttttggcttacaatgggaaagacacactgcataacaaagagcttgtc
tatttccctggtaaaaccgttaaaaaactaatgttagtcactgaggataacgaagctgtt
cctgaaaaaattggttgcgagggctttgtttgtgttgtgaccgatgtacaatcggagcct
tatgtaggcgatgatgctgaaactattcaatcccgtaattctacgtttataaattatgat
ggtcaaccagcagtgcgatttgctgacttggcggtttggaattcttataaaggaaaattg
ggaatcaccattaaaggccggttaggaagacgtgtcaaaagaaatggtgtattctttgat
ttgaaatattttgaccaagttgttgtaggattgaaggaggtaaaagacgctttttctttc
ttcatattcaatcgctttgtattggtgtatgttcctgcatataatggtgtggatcctgta
acactaaagcaaaaattgaacaaagagctccgagatcaccaccttttctcaagttgcttt
ccgcttgctgatataccgcgtaacgctgcaggaaaagtggatttgaagtctatcgaaact
tacgcatctaaatgcctttccgtagaagatcagcgcttacctgttttattaaaccctgtg
gctattgaaatcagtaaaattgcttcaaaaattctccaaaacccaagcttggaaggaaag
gacgcacctctttattcctgcggtttagattccattcattctgtgagattttttcatgct
attcaatcccactttcatcttgaaggcccaattcgctacaatatgaattcaaattgtacc
cctaactcgatagcctctataattcaaaagaaaagttacaacgtatcgtcaatcacctat
gaacttttaaatgaagatgcatgcgctttatcacgtaccattcccaagttaagtattctg
cctaccaatggtcaatatttcttgttaactggagcaacgggttattttggtcgtcgtttt
ttggaatatctagtaaagttgaatataagtgttgtatgtctagttcgagagtcctctgat
gaagctgctaaagaaaggttaatatcacttgttcctagtcttcgaatttcgagtgaaaat
ataattgtatgggcggctcatgtagaggagattagatttgggttggatgatgcaaaatgg
gagtttctggtggaaaatgtttcccgaatctatcacatggctgcggaagttcactggatg
aagtcgtatcaagaacttagaccagcaaatgttttggggactaagactgttttggaactg
agtgtgatgggacccaaggctctttactttatctctggaggtggacaacaggaagtagag
cttgacgatgatactcaatctgctaaagcatctggatatgcactatccaaatacgttgct
gagctcttgtgtcgaaagattagcgatttaggacatcccttaatatatgttattcgtcca
ggatttattatagcaaacgatggggaaattttatcgagagatttcttttggcgtttcgtc
gcgacagctttacgaatgggtatttggccacaaagcgatgaatcacaatctttggtattc
cacatttcaacaactgatgcattgtgcatgacgctgactcaaatattggagaaagaagct
gatgcgtatgctccacttttggcttatgataagtttgacggtgatgagtttgcttgtatt
tgtgaatctatgaaaaacgttaagctagactttgttacattggaggattggttgaaggca
cttgaaaaagatgtcgatgaaaaaggtgaagaccatcctctatttgctcttcagcatgca
accaagtttgctctgaaaagcagcatgacaccaagcaacgggctaaggaatatttatcct
ttgagtgaaacctttctaactaaggaagccattgcaaacgggctggagaatctatacatt
gaatag

DBGET integrated database retrieval system