KEGG   Schizosaccharomyces pombe (fission yeast): SPCC162.09cHelp
Entry
SPCC162.09c       CDS       T00076                                 

Gene name
hmg1
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase Hmg1
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00900  Terpenoid backbone biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
Module
spo_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPCC162.09c (hmg1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     SPCC162.09c (hmg1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Sterol-sensing HPIH Orthoreo_P10
Motif
Other DBs
NCBI-GeneID: 2538999
NCBI-ProteinID: NP_588235
PomBase: SPCC162.09c
UniProt: Q10283
Position
III:1561986..1565147
Genome map
AA seq 1053 aa AA seqDB search
MIYKLAARYPIQVIAIVGILVSMAYFSFLEALTQEDFPVLIRALKRFGILDGFPNTRLPN
EMILKLSSVQGEDASVWEQIPAAELGGEGFVDFDITQWYYPANAKVDVAQLVEPYRNDCI
FHDASGACHFFFKEVGNWTVSSIALPSNLANPPIDYFLDSSSTVIQRILPAIREHGISWS
WLLQLIARTWMNTLKIASQASKTELLIVGTAYACMLISIVSLYLKMRRLGSKFWLFFSVL
LSTLFSVQFAMTLVRASGVRISLVSLIESLPFLINVVALDKAAELTRQVITRCSVSDSHS
PMHEDIAKACRNAAPPILRHFSFGIVVLAIFSYCNFGIKQFFLFAAVMIYDLLLLFSFFV
AILTLKLEMRRYNAKDDVRKVLIEEGLSESTARHVADGNDSSATTSAGSRYFKVRYGTKI
ILFIFIAFNLFELCSIPFKHYAATSAAAARLIPLVRSQYPDFKSQRLLDDGVFDDVLSAI
SSMSNIESPSVRLLPAVFYGAELSSTSFLSTIHSFINNWSHYISASFLSKWIVCALSLSI
AVNVFLLNAARLNSIKEEPEKKVVEKVVEVVKYIPSSNSSSIDDIQKDEIAQESVVRSLE
ECITLYNNGQISTLNDEEVVQLTLAKKIPLYALERVLKDVTRAVVIRRTVVSRSSRTKTL
ESSNCPVYHYDYSRVLNACCENVIGYMPLPLGVAGPLIIDGKPFYIPMATTEGALVASTM
RGCKAINAGGGAVTVLTRDQMSRGPCVAFPNLTRAGRAKIWLDSPEGQEVMKKAFNSTSR
FARLQHIKTALAGTRLFIRFCTSTGDAMGMNMISKGVEHALVVMSNDAGFDDMQVISVSG
NYCTDKKPAAINWIDGRGKSVIAEAIIPGDAVKSVLKTTVEDLVKLNVDKNLIGSAMAGS
VGGFNAHAANIVTAVYLATGQDPAQNVESSNCITLMDNVDGNLQLSVSMPSIEVGTIGGG
TVLEPQGAMLDLLGVRGAHMTSPGDNSRQLARVVAAAVMAGELSLCSALASGHLVKSHIG
LNRSALNTPAMDSSAKKPATDALKSVNSRVPGR
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgatttataaacttgctgctcggtatccaattcaagtgattgccattgtgggcatcctt
gtctctatggcatatttttccttcttggaagccttaactcaagaagatttcccagtatta
attcgtgctttaaaacgatttggtattttggatggatttccgaacactcgtctacctaac
gagatgattttaaagctaagtagtgtccaaggtgaggatgcctcggtttgggaacaaatt
cctgccgcagagttgggtggagaaggatttgttgattttgatatcacccaatggtattac
cctgcgaatgcaaaggtcgatgttgctcaattggtagagccatatcgtaatgactgcatt
ttccatgacgcttccggtgcttgccatttcttttttaaagaggtcggcaattggactgta
tctagtattgcattaccatcgaatctcgccaatccgcccatcgattacttccttgacagt
tctagtactgtcattcaaagaattcttcctgcaattcgtgaacacggcatttcatggtcg
tggttacttcagttgatcgctcgcacttggatgaatactttaaagatcgctagccaagct
tctaagaccgaactgttaattgttggtactgcttatgcttgcatgttgatatccattgtg
tctctttaccttaagatgcgtcgtctaggatccaaattttggctattttttagtgtcctg
ctttccactttgttctctgttcaattcgcaatgactttggtacgtgcatctggtgtacgg
attagccttgtctcgttgattgaaagtttgccttttctgataaatgtggttgcccttgat
aaagctgcagaattaacgcggcaagttatcactcgatgctctgtctctgactcccattct
cctatgcatgaagatattgcaaaggcttgccgcaacgctgcaccgcctatcctccgtcat
ttttcttttggaatagtcgttttggcaattttttcgtattgtaattttggtatcaaacaa
ttctttttgtttgctgctgtcatgatttatgatttactcttactgttctctttctttgtc
gccatactcaccctgaaacttgagatgcgccgctataatgctaaggatgatgttcgaaag
gttcttatagaagagggtctctctgagtctacggctcgtcatgttgcagacggcaacgat
tcttcggctactacttctgcagggtcacggtattttaaagttagatatggaaccaaaatc
attcttttcatattcattgccttcaatttgtttgaactttgttctattccgttcaaacat
tatgctgccacttctgctgctgctgctcgattaattcctcttgttcgctctcaatatccc
gattttaagtcacaaaggcttttggatgatggagtgtttgacgacgttctttctgctatt
tcttcaatgtccaacattgaatcaccaagcgtccgtttactaccagctgttttttacggt
gccgaattatccagcacttcttttctatctactatccattcgtttattaacaactggtct
cactacatcagtgcttcgtttttgtcaaaatggatcgtctgtgctttatctttgagtatt
gccgtcaacgtttttcttttgaacgctgctcgattgaactccatcaaagaggaacctgag
aaaaaggtggttgaaaaagttgttgaagtcgttaagtatattccttcgtcgaatagttca
tccattgatgacattcagaaagacgaaatcgctcaagaatccgttgtacgttcgcttgag
gaatgtatcactctttacaacaatggtcaaatttcaactttaaatgatgaagaagttgtg
cagttaaccttagctaaaaaaatccctctttatgctttagaacgagtacttaaagacgtt
accagagctgttgtaattcgccgaacggtcgtctcccgttcatctaggacgaagacactt
gaaagctctaattgccccgtctatcattacgattactctagggttttgaatgcatgttgt
gaaaacgttataggttacatgcccttgccccttggtgtagctggtcctctcattattgac
ggtaagcctttttatatccctatggctactactgagggtgcattggttgcttctactatg
cgtggatgcaaagctattaacgctggtggtggtgctgttactgtattgactcgtgatcaa
atgtcccgtggaccatgtgtggctttcccgaatttgacgcgcgctggtcgtgctaaaatt
tggttggatagccctgaaggccaagaggttatgaagaaggcttttaactctactagccgt
tttgctagacttcaacatattaagactgctctagctggtactcgtcttttcatccgtttc
tgtacgtctaccggtgatgctatgggtatgaatatgatttccaaaggtgttgagcatgca
cttgtagtaatgagcaatgacgctggttttgatgacatgcaagtgatcagtgtatcaggg
aattattgtacagataagaagcctgctgctattaattggattgatggtcgtggtaaaagt
gttattgctgaagctattattcctggtgatgctgtcaaatcggtattgaaaactactgtt
gaagatttggttaaattaaatgttgacaaaaacctcattggtagtgctatggctggcagc
gttggaggatttaatgctcatgctgctaacattgtcacggcagtatatttagcaactggt
caagaccctgcccaaaatgttgaaagcagtaattgtataactttgatggataatgttgat
ggtaaccttcagcttagcgtgtcaatgccatccattgaagttggaacaattggtggtgga
acggttttggaaccgcaaggtgctatgcttgacttgctcggtgtgcgaggtgcccatatg
acctctcccggtgataattctcgtcaactagcacgtgtcgttgcagccgccgtaatggct
ggtgaactgtctttgtgttccgcacttgctagtggccatttagttaaatcccatatcgga
ctcaatcgaagtgcgctgaatactcctgctatggactcttctgccaagaaaccagcgact
gatgctctaaaatccgttaactctcgagtaccgggacgttga

DBGET integrated database retrieval system