KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1620.04c
Entry
SPCC1620.04c      CDS       T00076                                 

Gene name
mug55
Definition
(RefSeq) Cdc20/Fizzy subfamily WD repeat protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 Ge1_WD40 eIF2A CNH TFIIIC_delta
Other DBs
NCBI-GeneID: 2539258
NCBI-ProteinID: NP_588462
PomBase: SPCC1620.04c
UniProt: O94411
Position
III:complement(2149379..2150908)
AA seq 509 aa
MIIKKKESFKSPGRLWRVTKIRKLTAAKKNELQNRKCNQASNEEKKILYKSNFLDRFIPS
KANSDAFRIMENAFTEKLNTQESLLPDILNLNVKGVLHYKDNKKQKTTRLIESTNYQRQT
IHGASSSLVIEVEENGHLSNMQGSLYETPLRILDAPGLLDDFYISPLAWSTNGELAVALA
QNVYLWSEISGPSIMELSPTTYEVSSLAYSSDGGFLAIARVNGFVEIWNRKTKNNRCDYK
FHHDGDISCMAWSPINWTLLVGGSTGNIYVYRRTKSMMRRVHTIKKVHQEQVCGLEWNYD
GTQFASGGNDNLVCIFDIDSLENKKFYWIHLAAVKALAFCPWQKSLLAVGTGSNDQQIYF
YDTFRGHRIHSLFCGAQVTSVIWSRRYKEFCYSLGYSPEGTNSSLIVYRWPQLTKVFDIP
SAAIDGWGQDLRTIMAIHTHRKYSNNTWEEGEYVVVANSDETVKFYKIWGNEMQEIHNDR
VLYREGIFGSHILEMLENIPEQVLTNGVR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgataattaaaaagaaagaatcatttaaatctcctggaagactatggagggtcacaaaa
ataagaaaactcactgccgcaaaaaaaaatgaattacaaaatagaaaatgtaatcaggct
tcgaacgaagaaaaaaaaattttatacaaaagtaactttttagaccgtttcattccttca
aaagcaaattcggatgctttccgaattatggagaacgcgtttaccgaaaagctcaacacc
caggagagtctgctacccgatatattaaacttgaatgtcaaaggagtattgcattataaa
gacaacaaaaagcaaaaaacgactcgtttaatagagagtacaaactaccaaagacaaacg
atacacggtgcttctagttcattggtaatagaagtagaagaaaatggacatttatcaaat
atgcaaggaagtttatatgaaacacctttacgaatcctagacgctcctggtttactggat
gacttttatatttctcctttggcatggtcaactaatggagaattagcagtcgccctagcg
caaaatgtgtatttgtggagtgaaatctctggaccttccataatggaattgagtcctacg
acatacgaggtaagcagtttggcttactcatcagacgggggttttctagcaattgctaga
gtgaacggctttgtggaaatttggaatcgaaagacaaaaaataacaggtgcgattataaa
tttcatcatgatggagacattagctgcatggcttggagcccaatcaattggactctctta
gtaggaggcagtacagggaacatatacgtttaccgtcgaacaaaaagcatgatgcgtaga
gttcacactatcaaaaaagtccatcaagaacaagtttgcggattggaatggaactacgat
gggactcagtttgcaagtggtggaaacgataacctggtatgcatttttgacatcgattcg
ctagagaacaaaaagttttactggattcacttggctgctgtcaaggctctggccttttgt
ccttggcaaaaatcattgctggcagttggtacaggttctaatgatcagcaaatttatttt
tacgacacgtttcgagggcaccgaatccacagcttgttctgtggtgcacaagttacctcc
gtcatttggtcaagaagatataaagagttttgctatagtttgggctattctccagaaggg
actaactctagtttaattgtctatcgatggcctcaactgacaaaagttttcgatattcca
tctgcagcaattgatggttggggacaggatttgagaacgatcatggcgatacacacgcat
cgcaagtactctaacaatacttgggaagagggtgaatacgttgtggttgctaacagcgat
gaaacagtaaaattttataagatttggggaaacgaaatgcaagagattcataatgataga
gttttgtaccgagaaggaatattcggtagtcatatcttagaaatgctggaaaacattcct
gagcaagtgttaactaatggtgttcgttaa

DBGET integrated database retrieval system