KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1620.11
Entry
SPCC1620.11       CDS       T00076                                 

Gene name
nup97
Definition
(RefSeq) nuclear pore complex component nup97
  KO
K14309  nuclear pore complex protein Nup93
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    SPCC1620.11 (nup97)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPCC1620.11 (nup97)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     SPCC1620.11 (nup97)
SSDB
Motif
Pfam: Nic96
Other DBs
NCBI-GeneID: 2538861
NCBI-ProteinID: NP_588469
PomBase: SPCC1620.11
UniProt: O94418
Position
III:join(2165032..2165225,2165275..2167636)
AA seq 851 aa
MTVASDDSPKEARGIPFLDQKSRKLANELLEPCLPFIQFNLGEIEQRAKHYLNTVPTSKD
GNTKAHYLLAGSGINAEQTWKKIESLSLQVRPPTTLELSFTDVDMFLKYHREKNVLNSLE
ALVQNTQIAFDQYLEEEWRSKAAKSRPSFDNILLENKKRVSFYPFSVQRSQKFASTLKMC
LEEEALHGFQSKLVSSFCEVAREFAHDTKSLLLYESWKLLSSVILDKDSVTVFGNKGIIS
KAFDIETEDGSVNSRFYQRISDCSRKFLEAQFFEVLNKEIAKTPQAALVGGVPSIRNKIR
AYLNIRLLRNGVWINPDLEIIQDVPIWAFIFYLLRCGFLKEAVDFTEENRDLFEKVAEKF
PFYINAYAKAPNGILPRQLRSQLFSEFNQTIRLQESSDPYKYAVYKIIGRCDLSKTSCPS
ICSVTEDYIWFQLILSREFTEKSVSAHEFFSLEDVQHILLSYGSDYFTNNGSNPVMYFFL
LMLCGLYERAINFLYPYFPTDAVHFAITCAYYGLLRTAPSSSVVSNEPGKIQSMLVETKS
GKPSLEFDRLLIDYTQTCQELSPVMSACYLIPMCKIDKYISMCHKSLCSLVLSTRDYVNL
LGDIRGDGERTPSFLENHRSLIGLSSVKEYLSKITLTAAKQADDQGLLSDAILLYHLAED
YDAAVTVINRRLGSALLRFLDQFVFPDKLISLTKSMMDVYNRNPSLYAKVDYKNRETTNL
LLLTVEAFNAYTNKDYEQALSSLQQLEILPLDPLDSDCETFVVRKLAKEFRFLNENLLQN
VPGIVLIAMNSLKELYAKQKSSSFGNDAISVDKLRLYRQKARRIVMYSFLIEYRMPSQIL
EQLNRCEIEMT
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgacggttgcgtctgacgattcaccaaaggaagctagaggcataccttttttagatcaa
aagtctcgtaaacttgctaatgagttgttggaaccatgtcttccgtttatccagttcaat
ttgggtgagattgaacaacgcgcaaaacattacttgaacaccgttcctactagtaaggat
ggtaatacaaaagcccattatttgcttgctggaagcggtattaatgccgaacaaacatgg
aagaaaattgagtcgctctctctacaagtaagacctcccactactctcgagttgtccttt
accgatgtagatatgtttttgaagtatcatcgagaaaaaaatgttttaaattctttggaa
gcattggtacaaaacacccaaatagcgttcgatcaatatttggaagaggaatggcgttcc
aaagctgcaaaaagcagaccctcctttgataatattttacttgaaaataaaaagagagta
tccttttatcctttctcggtgcaacgttcgcagaagtttgcttccactttaaaaatgtgt
cttgaggaggaagcactgcacggatttcaatcaaagcttgtcagttctttttgtgaggtt
gcaagagaatttgctcatgatacaaagtctcttctcctttacgaatcctggaagttactt
tcctctgttatattggataaggattctgtgacagtgtttggcaataaaggcataatctca
aaagcctttgacattgagactgaggatggctcggttaactctcggttctatcaaaggatt
tctgactgttcccgtaagttccttgaagctcaattttttgaagttttgaataaggaaatt
gcaaaaaccccccaggctgctttggtaggcggtgttccttcaatacgtaacaaaattcga
gcgtatttgaacattcgtctattaaggaacggtgtttggattaatccagatttagaaata
atccaagatgttcctatatgggctttcatattctatctattacgatgtggttttttaaag
gaagcagtggactttactgaagaaaacagagatctttttgaaaaggtggctgagaaattt
cctttttatatcaatgcttatgcgaaggctccgaatggtattttaccaaggcaacttcgg
agtcaattgttttctgagtttaatcaaaccattcgtctacaggaatcttctgatccttat
aagtatgcagtatacaaaataattggacgctgcgacctttctaaaacttcgtgtccatcg
atttgttctgtcactgaagattacatctggttccagttaattttgtcacgtgaatttact
gaaaaaagcgtttccgctcacgaatttttttcattggaagatgttcaacatattttgctt
tcgtatggctccgattattttactaacaacggatctaatcccgttatgtacttctttttg
ttaatgctttgtggtctttacgagcgtgccattaattttttatatccttattttccaacc
gatgcagtccattttgccattacttgcgcatactacggtctgttgcgcactgcaccttct
agctcagttgtcagtaatgaacctggaaagattcaatcaatgctggttgaaacaaaatct
gggaagccttcccttgaattcgatcggttgttaatcgattatacccaaacttgtcaagaa
ttaagtcctgtaatgtctgcctgttatcttataccaatgtgcaaaattgataaatatatc
tcgatgtgtcataaatctctgtgcagtttggtactttctactcgtgattatgttaatctt
cttggcgatatacgtggtgatggcgagaggactccttcctttttggagaatcacaggtct
ttgattggtctttcttctgtaaaagaatacttatcaaaaatcactcttactgctgctaaa
caggctgatgatcagggattattatctgatgccattcttttatatcatttagctgaggat
tacgatgcggcagtaacagttataaatagacggctgggctctgcattgctaaggtttttg
gaccagtttgtttttcccgataaacttatatctttaactaaaagtatgatggatgtatac
aacagaaacccttctttgtatgccaaagtggattacaaaaatcgcgagacgacgaatttg
cttttattgactgtggaggcgttcaatgcatataccaataaagactatgaacaagcttta
tcgtctttacagcagttagaaattttaccccttgacccacttgactcagactgtgaaact
tttgttgtgagaaaacttgcaaaagaatttcgatttctcaatgaaaatttattacaaaac
gtacctggtattgttttaatagccatgaacagccttaaagaactttatgctaaacaaaaa
tcttcatcttttggaaatgacgctatatccgtggataagttacgcctatatagacaaaaa
gcacgaagaattgtcatgtacagtttcctgatagaatatcgtatgccttctcaaattctt
gaacagttaaatcgctgcgaaatagaaatgacatga

DBGET integrated database retrieval system