KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1620.14c
Entry
SPCC1620.14c      CDS       T00076                                 

Symbol
snf22
Name
(RefSeq) ATP-dependent DNA helicase Snf22
  KO
K11786  ATP-dependent helicase STH1/SNF2 [EC:5.6.2.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPCC1620.14c (snf22)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1620.14c (snf22)
Enzymes [BR:spo01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-  
     SPCC1620.14c (snf22)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SWI/SNF complex
     SPCC1620.14c (snf22)
    RSC complex
     SPCC1620.14c (snf22)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   RSC complex
    SPCC1620.14c (snf22)
   SWI/SNF complex
    SPCC1620.14c (snf22)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C Bromodomain ResIII QLQ SnAC HSA
Other DBs
NCBI-GeneID: 2538881
NCBI-ProteinID: NP_588472
PomBase: SPCC1620.14c
UniProt: O94421
Position
III:complement(2172623..2177665)
AA seq 1680 aa
MFAVQGNQKFPKGLTKDNIQSLYQQWQVMRNQGATEENNPEFAQISSILRMVQRAHYARM
QQMRNQSSEFPDAENTNLRKQQDTLPTTGFNNLPEGKAGMQTLPGRPASNGPTPPNPGNG
NVGLNNPSYMNSQASPNIMNAPLQRDTSVPPAPSMVHPHTNTNANSNNLKVYANQLSQQN
TSNPTYHNAYDMASMMKNGSRMNNSFPPTTPYPPANDTTVNSSLPHSFASPSSTFEQPHT
VQSRAPSVDTTSSSHSFSARNIPANVSMQQQMGRRGSIPVNPSTFSASSPPSGSMLASPY
NGYQNDAASFAHSKLPSSANPNTPFNSTATVDVGAAGSHFPYPQPSNLDAINAKTYFQSS
SNSPAPYVYRNNLPPSATSFQPSSSRSPSVDPNTVKSAQHIPRMSPSPSASALKTQSHVP
SAKVPPTSKLNHAQLAMLKSQIVAYNCLNSPNGQVPPAVQQAIFGRVYGASNEVSPSMPF
QQNVPQMSSVKKDTPTRDANMRTSKAPYIQNIPNQFQRRAYSATIPVKNESLAKPSVSPM
PLQQSTGKTEVAKRAQFPTNVNYSSCVDPRTYVKTPIPFSKFSSSENLSLIPSLLPPSIS
WDDVFLSSEIAIACSIANRIDFLEKENRPKSVNKKILQQDKSKSMIELRCLRLLEKQRSL
RETINSVIPHSDSLAAGNLRLMFRNVKRQTMQEANLVLALAEKQKTEHAMRQKEKLLTHL
RSIMLHRKSIVTKVDKQNKAKTQRCKDIINFHAHLEKEEKKRIERSARQRLQALRADDEA
AYLQLLDKAKDTRITHLLKQTDQYLENLTRAVRIQQSNIHSGNTSGKGSNSAELEAPISE
EDKNLDYFKVAHRIHEEVEQPKIFVGGTLKDYQLKGLEWMLSLYNNNLNGILADEMGLGK
TIQTIAFITYLIEKKNQQGPFLIIVPLSTLTNWIMEFEKWAPSVKKIAYKGPPQLRKTLQ
SQIRSSNFNVLLTTFEYIIKDRPLLSRIKWVHMIIDEGHRIKNTQSKLTSTLSTYYHSQY
RLILTGTPLQNNLPELWALLNFVLPKIFNSIKSFDEWFNTPFANTGGQDKIGLNEEEALL
IIKRLHKVLRPFLFRRLKKDVEKELPDKVEKVIKCPLSGLQLKLYQQMKKHGMLFVDGEK
GKTGIKGLQNTVMQLKKICNHPFIFEDVERAIDPSGTNVDLLWRAAGKFELLDRILPKLF
LTGHKTLMFFQMTQIMTIMEDYLRSKNWKYLRLDGSTKSDDRCSLLAQFNDPKSDVYIFM
LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQTKEVRILRLITEKSIEEN
ILSRAQYKLDLDGKVIQAGKFDNKSTPEEREAFLRSLLEHDGDDDHDLTYGELQDDELNE
LISRTDEELVLFKKLDKERAATDIYGKGKPLERLLTVNELPDFYKVEVDSFAVQSSSELE
DQYLERKRRRRNSISYTELTLDELNTVDDPSSTLMPRKRGRPRKKTNSGSSLSTPLSQES
SLARSGRKNTPSYKQKALRRYCMEIFERLYNLQSEDGRFVNGLFLYPPNRKLYPDYYIII
KRPIALGKIKRNIKNDRYGDVGELIADFMLMFNNAYTYNEEHSIVYEDAKLMEKTLKEVI
EDLEKNNSLHAYEEEALNEEQASLVFLENSEAELPLDSGIVSAEDDKVITYEDSSSSYSE
NT seq 5043 nt   +upstreamnt  +downstreamnt
atgtttgctgttcaagggaatcagaaatttccgaaagggttgaccaaggataatatacaa
tctctttatcaacaatggcaggtaatgagaaaccaaggtgctacggaggaaaataacccc
gagtttgctcaaattagttccattttaaggatggttcaaagagctcattatgcccgtatg
cagcagatgcggaaccaatcttctgaatttcctgatgctgagaacaccaatcttcgaaag
cagcaggatactcttcctactacaggatttaacaatctcccagaaggaaaagctggtatg
caaactcttcctggtaggcctgcttctaatggaccaacccctcctaaccctggcaatgga
aatgtcggattaaacaatccttcctacatgaatagtcaagcatcgccaaacattatgaat
gctcctttacaaagggatacttcagtacctcctgcacctagtatggttcatccacataca
aatacgaatgcgaatagtaataatttgaaagtgtatgcgaaccaactatcccaacaaaac
acctccaatcccacttatcataatgcttatgatatggcatccatgatgaaaaatggttct
cgtatgaataactcttttcctcctaccacaccttatccacctgctaacgacactactgtc
aattcctctcttcctcattcctttgcctccccttcgtccacatttgaacaaccacataca
gttcaatcgagagctccgtcagttgatacaacatcaagttctcacagctttagtgctagg
aatatacctgctaatgtctcgatgcagcagcaaatgggccgaagaggctcgatacctgta
aacccatcaactttctcagcttcttcccctccgtctggttctatgttggcttctccatac
aacgggtatcagaatgatgctgcttcctttgctcattcgaagctcccttcttccgcaaat
ccaaatactccttttaactctacggctactgtagacgttggtgcagccggttcgcatttt
ccctatcctcagccctctaaccttgatgctattaatgctaaaacatactttcaatcttct
tctaattccccggcaccatatgtatatagaaataacctaccgccttctgcaacttctttt
caaccttcttcatctcgatcaccttcagtagatccaaatactgtgaagtctgcgcagcat
atacctcgaatgtctccctcaccctccgcatcagctttaaaaacacaatctcacgtacct
tctgcaaaagtgcctcctacttccaaacttaatcatgctcaacttgctatgctgaaaagt
cagatagttgcatataactgtttgaattccccaaatggacaagtccctcctgctgtgcaa
caagccatatttggcagggtctatggagcttcgaatgaagtttctccttcaatgccattt
cagcaaaacgttcctcaaatgtcgtctgtaaagaaggatactcctacaagagatgcaaac
atgcgtacctctaaggcaccctacattcagaatattccaaatcaatttcaaagacgagcc
tattctgctacgattcctgtcaagaatgagtctcttgcaaaaccatcagtttcacctatg
ccgttacaacagtcgactggaaaaaccgaggttgctaaaagagcacagtttcccacaaac
gtcaactactcttcttgcgtagatccaagaacttatgttaaaacgcctattcccttcagt
aagttttcctcttcggaaaacctatcgctcatcccatcactcttgcctcctagtatatca
tgggatgatgtttttctctcttctgagattgcaattgcttgttcaattgctaacagaatt
gattttctagaaaaggagaacaggccaaagtcggtgaacaaaaaaatattgcaacaagac
aagtcaaaatcaatgattgagttgcgttgtctgcgtttattagaaaaacaacgatctcta
cgcgagacaataaattcagtcattcctcactcggatagtttggctgcaggaaatttaaga
cttatgtttcgaaacgtgaaacggcaaacgatgcaagaagccaatttagttttagccctt
gctgagaaacaaaaaaccgaacatgccatgagacaaaaagaaaagcttctaactcaccta
aggtctatcatgctgcacagaaagtcaattgtgacaaaagtggacaagcagaataaagct
aaaactcagcgatgcaaggatattataaattttcatgcccatctagaaaaggaagagaaa
aaacgaatcgaacgtagtgctcgtcaaagattacaggctctccgtgctgatgacgaagcc
gcatatttgcagttactagacaaggcgaaagatactcgtatcactcatcttttaaaacaa
actgatcagtatttggaaaatcttacacgtgccgtccggattcaacaatccaatattcac
agtggaaatacttctggaaaaggtagcaattctgccgaattagaagccccaattagtgag
gaagataagaatcttgattattttaaagtggctcaccgtattcatgaagaggttgagcag
ccaaagatttttgttggtggcactctaaaagactatcaattgaagggtcttgaatggatg
ttgtcgctatacaataacaacctcaatgggatcctggctgacgagatgggtttgggtaaa
acaatccaaactattgcgtttatcacatatttgattgagaaaaaaaatcagcaaggacca
tttcttattatagtaccattgtctactctaacaaattggattatggaattcgaaaaatgg
gctcccagtgttaagaaaatagcttataaaggccctccgcaattgagaaaaacattacaa
tcccaaatccgatctagcaatttcaacgtcttgctcaccacatttgaatatatcattaag
gatcgtcctttactttctcggattaaatgggttcacatgattatagatgaagggcaccgt
ataaaaaatacccaatcaaagttaacgagtactttatctacttattatcattcccagtat
cgtctcattttgactggtacacctttgcaaaataacctaccagagctttgggctcttctt
aactttgtcttaccaaaaatcttcaattcaattaaaagttttgatgaatggttcaataca
ccttttgctaatactggtggacaagataaaatagggcttaatgaagaagaagctttactt
attataaaacgtttgcataaagtccttcgaccatttttgttccgaagacttaaaaaagac
gtcgaaaaggagctacccgacaaggttgagaaagtcatcaagtgccctctttcaggcttg
caattaaaattgtaccaacaaatgaagaagcatggtatgctttttgtggatggtgagaaa
ggaaaaacgggtattaaaggactacagaacacggttatgcaacttaagaagatatgcaat
catccgttcatatttgaagatgttgaaagagccatcgatccatccggaactaacgtcgac
ttgctttggagagctgctggcaagtttgagctgttagatcgtattcttccaaagctgttt
ttaacaggtcataaaacccttatgttctttcaaatgactcagatcatgactataatggag
gattatttgcgatcaaagaattggaaatatcttcgtttagatggttcaacaaaatctgac
gatcgatgctcccttcttgcacagttcaacgatccaaagtcagatgtttacattttcatg
cttagtactcgtgctggtgggttgggtctcaacttacaaactgctgacactgtcataatt
tttgataccgattggaatccccatcaggatttgcaagctcaagatcgtgctcatcgtatc
gggcagaccaaagaggtgcgaattctccgtttgatcacggaaaagtctattgaagagaac
attctttctcgagctcagtataagcttgaccttgatggaaaagttatccaagctggtaag
tttgacaacaagtctacacctgaggagcgtgaagcttttttacgttctttacttgaacat
gatggcgacgatgatcatgacttaacttacggcgaacttcaagatgatgagttgaacgag
ttgatttctagaacagatgaagagctcgtactttttaaaaaattagataaagaacgtgca
gctaccgatatatatggtaaaggtaaaccgctggaacgtttacttactgtaaatgaactt
cctgacttttataaagtcgaggttgacagttttgcagttcaaagctctagtgagttggag
gatcagtatctcgaaagaaagcgacgtcgtcgtaattctatcagttatacggaattaacc
ctcgacgaattaaatacagttgacgatccatcttccactctaatgccgcgtaaaagaggt
cgaccgagaaaaaaaacaaactcaggctctagtctatcaacccctttatcacaagaatcc
agtttggccagaagtggtcgaaaaaatacaccttcatataagcagaaggcacttagaaga
tattgtatggaaatctttgaaaggctgtataatcttcaaagtgaagacggcagattcgtt
aatggtcttttcctttatcctcccaaccgcaaactttaccctgattactatataataatt
aaacgacccatagctcttggaaaaattaaaaggaatattaagaatgaccgttatggagat
gttggagaactgattgcagattttatgctcatgtttaataatgcatatacctataatgaa
gagcattcaattgtttacgaggatgcaaaattaatggaaaaaactctaaaggaggtgatt
gaagatttagaaaaaaacaattctttgcatgcatatgaggaagaggctttaaatgaggaa
caagcatctcttgtctttttggaaaactctgaagcagagctaccgttggattctggtata
gtaagcgccgaagatgacaaagttattacttatgaagattcttcttcttcttattcggag
tag

DBGET integrated database retrieval system