KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1682.04
Entry
SPCC1682.04       CDS       T00076                                 
Symbol
cdc31
Name
(RefSeq) centrin
  KO
K16466  centrin-3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPCC1682.04 (cdc31)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1682.04 (cdc31)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     SPCC1682.04 (cdc31)
    Nuclear pore complex
     SPCC1682.04 (cdc31)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    SPCC1682.04 (cdc31)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 Caleosin Dockerin_1 DUF5580_M
Other DBs
NCBI-GeneID: 2539261
NCBI-ProteinID: NP_587797
PomBase: SPCC1682.04
Ensembl: SPCC1682.04
UniProt: O74435
Position
III:378192..381250
AA seq 176 aa
MFANARAKRRSRASSPTPARLGGYAPLRVEITEEQRQDINEAFKLFDSDKDNAIDYHELR
AAMRALGFNAEKSEVLKILRDFDKTGKGYLQMEDFVRVMTEKIVERDPLEEIKRAFELFD
DDETGKISLRNLRRVAKELNENIDDQELEAMIEEFDLDQDGEINEQEFIAIMMDEA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttgctaacgcacgggctaaaaggcgttcaagggcatcttcaccgactcctgcaagg
ttgggaggatatgcgcctttgcgagtagagattacagaggaacagcgacaagatattaat
gaagcttttaagctgtttgactctgataaagataatgctattgattatcatgagctcagg
gctgcgatgcgtgctttagggtttaatgcggaaaaatcagaggttttaaaaattctacgt
gattttgataaaactggcaagggctacttacaaatggaggattttgttcgcgtcatgacg
gaaaaaattgttgaacgagatccattagaagagattaaaagggcttttgagttatttgat
gatgacgagacaggaaaaatcagtttaaggaatcttcgaagagttgcaaaagagcttaat
gaaaacatcgacgatcaggaattggaagccatgattgaagaattcgaccttgatcaggat
ggagaaattaatgagcaagaatttatagcaattatgatggatgaagcataa

DBGET integrated database retrieval system