KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1682.07
Entry
SPCC1682.07       CDS       T00076                                 
Symbol
ssl1
Name
(RefSeq) transcription factor TFIIH complex subunit Ssl1
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPCC1682.07 (ssl1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPCC1682.07 (ssl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPCC1682.07 (ssl1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC1682.07 (ssl1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPCC1682.07 (ssl1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPCC1682.07 (ssl1)
SSDB
Motif
Pfam: Ssl1 C1_4 VWA_2 VWA IBR
Other DBs
NCBI-GeneID: 2539194
NCBI-ProteinID: NP_587800
PomBase: SPCC1682.07
Ensembl: SPCC1682.07
UniProt: O74995
Position
III:384170..386047
AA seq 421 aa
MNENQKSFDSDKSESEDEQKNGRVKVRSRKTDDNEGYTWEGEYQRSWDIVQEDAEGSLVG
VIAGLIQSGKRKRLLRDTTPLQRGIIRHMVLVLDLSNSMEERDFHHKRFDLQIKYASEFV
LEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLRDCSGNFSLQNALEMARA
SLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNK
TNSSTKNAYGVVISEQHFRELLLESTIPPATDSAKTTDASLVMMGFPSKVVEQLPSLCAC
HSIPSRGGFHCPRCKAKVCTLPIECPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSANP
KSTHCFACQLPFPKPPVSPFDESTSSMRYACPSCKNHFCLDCDVFAHEQLHECYGCQCSG
N
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaatgagaaccaaaaaagttttgactctgacaagtcggaaagcgaggatgaacaaaaa
aatggaagagttaaagtaagaagcaggaaaactgacgataatgagggttatacttgggaa
ggtgaatatcagcgttcttgggatatcgtacaggaggacgcagagggtagtttagtaggc
gttatcgctgggcttattcaaagcgggaaacgtaaaagacttcttagagatacaactccg
ttacaacgaggtattattagacacatggtcttggtgttagatttgagcaactctatggag
gagcgtgattttcatcataagcggttcgaccttcagataaagtatgcttctgaatttgtt
cttgagttttttgaacaaaatcctatttcccaattatcgattataggcgtaatggatgga
atcgctcatcggataactgatttgcatgggaatcctcaatcgcatattcagaagcttaaa
tctcttcgagattgtagtggaaacttctctcttcaaaatgctctcgaaatggctagagct
tctttatcacacattgcttcccatggcactagagaagtccttatcatttttggttccatc
ttatcatcagaccctggcgacattttcaagacgattgatgctctggttcatgattctatt
cgtgtccgtatcgttggtttggctgctgaagtcgccatttgtaaagaaatttgtaataaa
actaactcatctacgaaaaatgcctacggcgtagtcatcagtgaacaacattttcgcgaa
cttctactcgaaagcacaatacctcctgctactgattcggctaaaaccactgatgcttct
ttggtaatgatgggatttccttctaaggtcgttgagcaattgccaagtctttgtgcttgc
cattcaattccgtctcgtggtgggtttcattgtcctcgttgtaaagcaaaagtttgtact
ttaccgatcgaatgccctagttgttctctcgttctaatcctttcaacacatcttgctcga
tcttatcatcatttgtttccattgaaaaactggagcgaaattccttggtccgcaaatcca
aagtccactcattgctttgcgtgtcagttaccttttccgaagccgccggtttcaccgttt
gacgaatctacttcatcgatgcggtatgcatgtccctcgtgtaaaaatcatttttgtttg
gattgcgatgtttttgcgcatgaacaacttcatgagtgttatggatgccaatgctccgga
aattaa

DBGET integrated database retrieval system