KEGG   Schizosaccharomyces pombe (fission yeast): SPCC16C4.10Help
Entry
SPCC16C4.10       CDS       T00076                                 

Definition
(RefSeq) 6-phosphogluconolactonase (predicted)
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00030  Pentose phosphate pathway
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01200  Carbon metabolism
Module
spo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
spo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPCC16C4.10
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     SPCC16C4.10
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 2538922
NCBI-ProteinID: NP_587920
PomBase: SPCC16C4.10
UniProt: O74455
Position
III:join(685901..686085,686204..686792)
Genome map
AA seq 257 aa AA seqDB search
MSVYSFSDVSLVAKALGAFVKEKSEASIKRHGVFTLALSGGSLPKVLAEGLAQQRGIEFS
KWEVFFADERIVPLDDENSNYALCKKLIFDKFEGFDPKKIHTINPELLKENPIDPQNVAD
EYEKQLVHVFANSSTVKVPVFDLLLLGCGPDGHTCSLFPDHEVLQEDVAWVAPVTDSPKP
PKDRITLTLPVVTHAQAIAFVTTGAGKKDILPIVIEDFTSKLPSALITRNNLTRTSWFVD
DEASANLERSSLKVFPQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttactcattttcagacgttagtttagttgcaaaggcacttggtgcattcgtt
aaagagaaaagtgaagcttctattaaaaggcatggcgtgttcactttagctcttagtgga
ggaagtttaccaaaggttttggctgaaggattggctcaacagagaggtatcgagttttcc
aaatgggaagttttctttgctgatgaaagaattgttcctttagatgatgaaaactcaaat
tatgcgctctgtaaaaagttgatttttgacaagtttgaaggatttgaccctaaaaaaatt
cataccatcaatcctgagcttttgaaagaaaatcctattgaccctcagaatgttgctgat
gaatatgaaaaacaattagtgcatgtgtttgcaaatagctccactgttaaggtccctgtg
tttgatttactgctgttaggatgcggtcctgatggccatacatgttctctattccccgat
cacgaggtactccaggaagacgttgcttgggtggccccagtcactgattcgcccaaaccc
cctaaagaccgcatcactttgactttaccggttgtcacacatgctcaagccattgccttt
gttaccacaggtgctggtaagaaggatattttgcctattgtcattgaggattttacatct
aaacttccaagtgcgctgatcactcgaaacaatttgactcgtacaagctggtttgtggat
gatgaagcatcagccaatcttgagagatcctctttgaaggttttccctcaatag

DBGET integrated database retrieval system