KEGG   Schizosaccharomyces pombe (fission yeast): SPCC16C4.16c
Entry
SPCC16C4.16c      CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: NCBP3
Other DBs
NCBI-GeneID: 2539386
NCBI-ProteinID: NP_587926
PomBase: SPCC16C4.16c
UniProt: O74460
Position
III:complement(join(697605..697752,697875..698127,698180..698399))
AA seq 206 aa
MDIVAETQIEEESLIPDATSTPLETEVVADTTLRKTALHLAGVDNLSEEQVKGFISAYAP
ESQCTIEWINDNECNVVYADDDVSRNALFHLIMESPTEFSEELEYQTKPHPTVPTCQFKI
RYARYGDKKVKSAHLYSRYYLFHGDPREEKAQKSKSKSRNQDERGSPLDERLGPKVSDLT
LMERIFQVRRKPRKSRRDRRSRVSKR
NT seq 621 nt   +upstreamnt  +downstreamnt
atggatatcgttgcagagactcagattgaagaagaatcattgatacccgacgccactagt
actccattagaaacggaagtggtggctgatactacattgcgtaaaacagctttacatcta
gctggcgtcgataatctttcagaagaacaagtcaaaggatttatttcagcttatgctcct
gaatctcaatgtacaattgaatggattaatgataacgaatgcaacgttgtttatgcggat
gatgatgtttcacgaaatgctttatttcatttaattatggagtctccgacagaattttca
gaggaattggaatatcaaacgaaaccacacccaactgtaccgacgtgtcaattcaaaata
cgttacgcccgctacggagacaagaaggttaaaagcgcacatctttactcgagatattat
ctgtttcacggtgatcctcgagaagaaaaggctcagaagagcaaatctaaaagtagaaat
caagatgaaaggggttcgccattagatgaacgactaggtcctaaagtgtctgaccttaca
ctgatggaaagaatattccaagttcgacgcaagccacgcaaatcaaggagagaccgtcgt
tccagggtttccaagcgttaa

DBGET integrated database retrieval system