KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1739.03
Entry
SPCC1739.03       CDS       T00076                                 

Gene name
hrr1
Definition
(RefSeq) helicase Hrr1
  KO
K11701  helicase required for RNAi-mediated heterochromatin assembly 1 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1739.03 (hrr1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPCC1739.03 (hrr1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Gene silencing
   RNA interference (RNAi) pathway
    RDRC (RNA-directed RNA polymerase complex)
     SPCC1739.03 (hrr1)
SSDB
Motif
Pfam: AAA_12 AAA_11 AAA_19 UvrD-helicase Viral_helicase1 AAA_30 AAA_22 PhoH DUF2075 ResIII AAA_16 AAA_5 Helicase_RecD
Other DBs
NCBI-GeneID: 2539248
NCBI-ProteinID: NP_588411
PomBase: SPCC1739.03
UniProt: O74465
Position
III:join(2029655..2031992,2032034..2032495,2032538..2032690,2032739..2032785)
AA seq 999 aa
MEQVQDEIWKLSTLDAWEMVNKNTEVVFDEIPEPETLSEMKRHPLYSNIFNADNNTTSFT
EQIETSETSKTQDSEGNKVDKNLKENKSIRRKRSIDNDYELSNVKRNDITSGKNREFENE
HHPASDTSSWRELPSIPTLEELTSKSVELPSNNIYGGYKSFEDYLSIHYRLLREDAVSPL
RESVLRYKVNPNYITGSSLAVYDHVRIDGYTISSSVIAAKLSFSVRAKKKIKWATSRRLI
SGSLVLLSNDDFQTFRIGTVCARPLSGLNKHPHEIDVKFEDISISLDPREEYVMIEATSG
YWEAYKHVLRSLQRLSASTFPMKDYLVHCKSNQETAKHIQNNPRIRINSILKNNSQKIVN
ALEPFGPGEYILDSSQLKAYQSMLTKRLSIIQGPPGTGKSFVTLKAIETLLENTHSHVLP
ILVACQTNHAVDQILIRLLHQGASVMRLGSRTKDPEIAAVTIFQKAKHTKHSFKAAYNEI
RHKKQRLIKQITNIMHNFNLEFVTLSYLHSKGIITTSQLESLRNNTEWISSVAENGEKTE
EELISIWLGDAKVELITPSEITDGFEEELQIDPEKLEEIQKEAEDSGALMEEELRGKFIN
LRCKYLFSKLTTLHEKEIDTLLTIPNIWDIPEYSRGIIYCRWLESAYAAAEKELNRLYRF
YLKVDRERIGFSNKRAAILLRGANVIGMTTTGLNKYRDILERINPKICFIEEAADVLEGP
IIPAVFPSLEQLVLIGDHKQLRPGCSTYALRQDPFNLSISMFERLVENDMEYTRLTMQRR
MHPQIRRLVSSVYEDLSDYEITKYWPSIPGMGEIRRFFLTHSRIEDNDGFASKINLFEAQ
MLVQFAVYLINNGVEPQKITCLTFYAAQKDLIERLLSESLNREKHFIKVATVDGYQGEEN
DVVLLSLVRNNDRTEVGFLSSPHRVCVSLSRARRGLFIFGNAQLVAESNPLWWDAINTLM
NDETIQGLGDHLPLFTKDGTIYVNDPVELLDVNMRLTRK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggaacaagtacaagatgaaatttggaagttaagtacgctggacgcctgggaaatggtg
aacaaaaatacagaagttgtgtttgatgaaatccccgagccagaaactttaagtgaaatg
aaaagacacccattgtatagcaacatctttaacgccgataataatactacgagtttcaca
gaacaaatcgagacttctgaaacctccaaaacccaagactcggaggggaacaaagttgat
aaaaatttaaaagaaaacaagtcaatacgtcgtaagagaagcattgacaacgattatgaa
ttgagtaatgtaaagagaaatgatataacatcgggaaaaaatagagaattcgaaaacgaa
caccatcccgcaagcgatacttcttcttggcgggaactaccatcaattccaacgttggaa
gaattgacgtcaaagagtgttgaattaccttcaaacaacatatacggaggatacaagtcc
tttgaagattacttatctatacactatcggttgctacgtgaggacgcagtttccccatta
cgagaaagtgtgcttcggtacaaggtaaaccccaattacattaccggctcttcgttagcc
gtatatgatcatgtgcggatagatggctatacaatatcttccagtgttatagctgcaaaa
ttatccttcagtgttcgcgctaagaaaaaaataaaatgggctaccagtcgtcgtcttatc
agtggatctttagttttattaagcaatgatgatttccagacttttcgcattggaactgtc
tgtgcgcggcccttgagtggccttaataaacatcctcatgaaatagatgtcaaatttgaa
gatattagtatctctttagatcctcgagaagaatatgttatgatcgaagctacttcaggc
tattgggaagcttacaagcatgttcttcgttcattacagaggctttctgctagcacattc
ccgatgaaggattacttggtacactgtaaaagtaatcaggagactgctaaacacatacaa
aataatcctaggatacgcataaattctatcttaaaaaataactctcaaaaaatcgtaaat
gctcttgagccgttcggtcctggcgagtatatactagactcgtcacagttaaaagcttac
cagtccatgctgactaagagactctccattattcaaggccctccagggactggtaaaagc
tttgttactcttaaagccatagaaacattacttgagaatactcactcccatgttcttccg
attttagtagcttgccaaacgaatcatgcagtcgatcaaatattgattcgtttattgcat
caaggcgcttcagtaatgcgactaggttcaagaacgaaggatcctgagattgcagcggtt
acgatttttcaaaaagcaaagcacaccaagcattcatttaaggctgcttataatgagatt
cgtcacaaaaagcaacgcttaatcaagcaaataactaatattatgcataatttcaacctt
gaatttgtaactcttagctatctgcatagtaagggaattataacgacctcgcaactcgag
tcccttcgtaacaacactgagtggatcagttctgttgcggaaaatggcgaaaaaactgaa
gaggaattaataagtatctggttaggcgatgctaaagtggagcttatcactccatcagaa
attacggatggttttgaggaggaactacaaattgatccagaaaagctggaagaaattcag
aaagaagcagaagacagtggtgctttaatggaagaggaattgagagggaaatttattaac
ttaagatgcaaatatctattttcaaagctaacaacacttcatgaaaaggagattgatacc
cttctcactattccaaatatttgggatataccagagtatagtagaggaatcatttactgt
cgctggttagaatcggcatatgcagctgccgaaaaagaactcaatcgtctctatagattt
tatctgaaagtagaccgcgagcgtattggtttttcaaacaaacgcgcagccattcttttg
cgtggagcgaacgtaattggaatgaccacaactggattaaataagtatcgtgatatatta
gaaaggataaatccaaaaatttgctttatcgaggaagcagcagatgtgttagaaggaccg
attattccagctgttttcccttctttagaacaattggttcttatcggtgatcacaaacaa
cttagaccaggttgttcaacttatgcattacgacaagatccatttaatttatcaatatct
atgtttgaacgattagttgaaaatgatatggaatatactcggttgacaatgcaaagaaga
atgcatccccagattcgaagattagtgagttctgtttacgaagatttatcggattatgaa
attaccaagtattggcctagtattccgggaatgggcgaaattaggagattctttttaact
cattctcgtattgaagacaatgatggctttgcttcgaaaattaatttattcgaagctcag
atgttagttcaatttgcagtctatctcattaataatggcgttgaacctcaaaaaattacc
tgcctaacgttttatgctgctcaaaaggatctaatagagcgattgttaagtgagtctctt
aatagagaaaaacattttattaaagtcgcgactgtagatgggtatcaaggggaagagaat
gatgtcgttcttctttctcttgtgcgcaacaatgaccggacagaggtcggatttctttcc
tccccacatcgcgtttgtgtttctttatctagagctaggagaggattgtttatatttgga
aatgcgcaacttgttgcggagtcgaatcccttgtggtgggacgcaataaataccctcatg
aatgatgaaacaatacaaggtctaggagatcacctacctttgtttaccaaagatggtaca
atttatgtaaatgatcctgttgaattgcttgacgttaatatgcgattgacaaggaaataa

DBGET integrated database retrieval system